FuNGI

A0A2A9PEC6

Protein Details

Accession

A0A2A9PEC6

Localization Confidence

High

Confidence Score

15.8

NoLS Segment(s)

Position	Sequence	Protein Nature
2-25	AAVAAVPRRRRIGRRRRVEDEGED	Basic

NLS Segment(s)

Position	Sequence
9-18	RRRRIGRRRR
71-86	RKSANGAPKRARPHPR
201-207	RGRGRGG

Subcellular Location(s)

mito 13, nucl 12.5, cyto_nucl 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018545 Btz_dom
Gene Ontology	GO:0005737 C:cytoplasm GO:0035145 C:exon-exon junction complex GO:0003729 F:mRNA binding GO:0006397 P:mRNA processing GO:0051028 P:mRNA transport GO:0000184 P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay GO:0006417 P:regulation of translation GO:0008380 P:RNA splicing
Pfam	View protein in Pfam PF09405 Btz

Amino Acid Sequences

MAAVAAVPRRRRIGRRRRVEDEGEDDGRTEPLDVDDESLTDGSLLTDDDDAAEDSDTSNIDEASPTSPGARKSANGAPKRARPHPRPSAAAADTDMMLHGLSMTDRSGPAQDMHFDDVVVSPPKSPSAPVVVSSASARRQPPPPPPPPPGISQGDRRRQEHDDYKRRRDVDPAFVPNRGSFFMHDHRHAGPASNGFRPFGRGRGRGGGRGGIGGIGGPFSPFNHHVSNPSDPTTSSPWTHDMHDMVADPTPRHPRHMPHSEGPPNGNGFIPTCEPSPTPINRTLSTEKHIGNAQVRVFFPHLMKGPTVFPGLPIKQYTKLPDHRPPLRRDKPVRISLPDHPPRYVFPAPDRSFTFIPRALRPNQQRMRGKPRSAWGSVGGFSRRTSILGGGSYYGSVYSPSIALSRRSSVAAHDRDMVFSPTGSAISRPAMPVDAARPVVRLPPSSRPPVMAMSEVVMEPAHLLETPMAAHEASISDLPQPQMHPLPQKPVVQENRPGSLPMHQPRPQKNISVADIESPTLTQGPQAFHQPFHQQVPLQVANGLSEAETHARGPVSYPSQHSTGTPLSQIPERAIHAAPFQPNSFGQQPYYGQQQAYPPPQPPPPQPPPPQQGFYYPQGFSGPVPAMAPSAAAPPFVPSGQHGFASPGQTEQPATQASFPHTPGVTSAASSNLVAQEVNGMVYYYDTSQIQPVGPVGPYAPYPAHQGFQPGVLGMGGVVTPSPDGFFYPQPAPGVVYYSH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.73
2	0.8
3	0.85
4	0.85
5	0.85
6	0.82
7	0.78
8	0.74
9	0.7
10	0.61
11	0.52
12	0.45
13	0.38
14	0.31
15	0.24
16	0.18
17	0.11
18	0.11
19	0.13
20	0.12
21	0.14
22	0.14
23	0.14
24	0.14
25	0.14
26	0.12
27	0.09
28	0.09
29	0.07
30	0.07
31	0.07
32	0.06
33	0.07
34	0.07
35	0.07
36	0.08
37	0.09
38	0.09
39	0.09
40	0.08
41	0.08
42	0.09
43	0.09
44	0.09
45	0.09
46	0.08
47	0.08
48	0.09
49	0.1
50	0.11
51	0.11
52	0.11
53	0.14
54	0.17
55	0.19
56	0.22
57	0.23
58	0.22
59	0.27
60	0.35
61	0.41
62	0.43
63	0.5
64	0.54
65	0.59
66	0.66
67	0.69
68	0.72
69	0.7
70	0.75
71	0.77
72	0.77
73	0.74
74	0.7
75	0.7
76	0.6
77	0.54
78	0.45
79	0.35
80	0.28
81	0.23
82	0.19
83	0.1
84	0.09
85	0.07
86	0.05
87	0.04
88	0.05
89	0.06
90	0.06
91	0.07
92	0.08
93	0.09
94	0.11
95	0.12
96	0.14
97	0.15
98	0.17
99	0.19
100	0.22
101	0.21
102	0.19
103	0.18
104	0.17
105	0.19
106	0.19
107	0.16
108	0.14
109	0.15
110	0.17
111	0.17
112	0.18
113	0.17
114	0.2
115	0.21
116	0.21
117	0.23
118	0.21
119	0.22
120	0.22
121	0.23
122	0.19
123	0.23
124	0.24
125	0.26
126	0.31
127	0.37
128	0.46
129	0.52
130	0.58
131	0.61
132	0.63
133	0.65
134	0.62
135	0.59
136	0.56
137	0.52
138	0.47
139	0.5
140	0.54
141	0.58
142	0.61
143	0.59
144	0.58
145	0.56
146	0.61
147	0.61
148	0.63
149	0.64
150	0.67
151	0.74
152	0.76
153	0.75
154	0.67
155	0.66
156	0.6
157	0.59
158	0.58
159	0.58
160	0.52
161	0.51
162	0.51
163	0.43
164	0.4
165	0.31
166	0.24
167	0.17
168	0.21
169	0.28
170	0.31
171	0.32
172	0.33
173	0.33
174	0.34
175	0.33
176	0.29
177	0.24
178	0.26
179	0.27
180	0.29
181	0.29
182	0.27
183	0.27
184	0.3
185	0.28
186	0.28
187	0.33
188	0.31
189	0.33
190	0.42
191	0.43
192	0.42
193	0.42
194	0.37
195	0.3
196	0.27
197	0.24
198	0.15
199	0.12
200	0.09
201	0.07
202	0.05
203	0.04
204	0.04
205	0.04
206	0.05
207	0.09
208	0.11
209	0.15
210	0.17
211	0.18
212	0.22
213	0.26
214	0.31
215	0.29
216	0.29
217	0.26
218	0.24
219	0.27
220	0.27
221	0.26
222	0.22
223	0.22
224	0.23
225	0.24
226	0.26
227	0.25
228	0.21
229	0.19
230	0.18
231	0.17
232	0.14
233	0.14
234	0.13
235	0.12
236	0.16
237	0.25
238	0.25
239	0.29
240	0.32
241	0.36
242	0.43
243	0.51
244	0.52
245	0.48
246	0.56
247	0.57
248	0.55
249	0.51
250	0.44
251	0.37
252	0.32
253	0.27
254	0.18
255	0.13
256	0.13
257	0.14
258	0.13
259	0.12
260	0.13
261	0.13
262	0.16
263	0.21
264	0.22
265	0.24
266	0.29
267	0.31
268	0.31
269	0.36
270	0.38
271	0.34
272	0.35
273	0.36
274	0.3
275	0.29
276	0.29
277	0.26
278	0.24
279	0.26
280	0.24
281	0.22
282	0.22
283	0.22
284	0.22
285	0.21
286	0.18
287	0.18
288	0.19
289	0.17
290	0.17
291	0.16
292	0.16
293	0.15
294	0.17
295	0.13
296	0.13
297	0.17
298	0.18
299	0.18
300	0.19
301	0.2
302	0.21
303	0.24
304	0.26
305	0.28
306	0.34
307	0.39
308	0.45
309	0.5
310	0.56
311	0.61
312	0.63
313	0.67
314	0.68
315	0.71
316	0.7
317	0.72
318	0.71
319	0.72
320	0.69
321	0.63
322	0.59
323	0.56
324	0.6
325	0.57
326	0.5
327	0.43
328	0.4
329	0.37
330	0.4
331	0.35
332	0.26
333	0.23
334	0.32
335	0.33
336	0.35
337	0.35
338	0.32
339	0.31
340	0.3
341	0.3
342	0.22
343	0.24
344	0.24
345	0.27
346	0.27
347	0.34
348	0.38
349	0.45
350	0.47
351	0.54
352	0.56
353	0.59
354	0.67
355	0.66
356	0.63
357	0.56
358	0.56
359	0.53
360	0.48
361	0.42
362	0.34
363	0.28
364	0.27
365	0.25
366	0.2
367	0.16
368	0.15
369	0.15
370	0.13
371	0.12
372	0.11
373	0.1
374	0.1
375	0.09
376	0.09
377	0.08
378	0.08
379	0.07
380	0.07
381	0.06
382	0.05
383	0.05
384	0.04
385	0.04
386	0.04
387	0.05
388	0.06
389	0.08
390	0.1
391	0.11
392	0.13
393	0.13
394	0.14
395	0.14
396	0.15
397	0.23
398	0.23
399	0.22
400	0.24
401	0.23
402	0.23
403	0.24
404	0.23
405	0.14
406	0.12
407	0.11
408	0.08
409	0.09
410	0.08
411	0.07
412	0.07
413	0.08
414	0.09
415	0.08
416	0.08
417	0.08
418	0.08
419	0.09
420	0.09
421	0.11
422	0.11
423	0.11
424	0.11
425	0.11
426	0.15
427	0.15
428	0.16
429	0.17
430	0.24
431	0.29
432	0.33
433	0.33
434	0.31
435	0.32
436	0.32
437	0.29
438	0.22
439	0.18
440	0.14
441	0.14
442	0.12
443	0.1
444	0.07
445	0.06
446	0.05
447	0.05
448	0.04
449	0.03
450	0.04
451	0.04
452	0.04
453	0.04
454	0.05
455	0.05
456	0.05
457	0.05
458	0.05
459	0.05
460	0.06
461	0.06
462	0.06
463	0.07
464	0.08
465	0.09
466	0.1
467	0.1
468	0.12
469	0.15
470	0.18
471	0.24
472	0.24
473	0.3
474	0.34
475	0.37
476	0.36
477	0.42
478	0.45
479	0.42
480	0.48
481	0.45
482	0.42
483	0.39
484	0.38
485	0.3
486	0.3
487	0.34
488	0.32
489	0.38
490	0.4
491	0.48
492	0.53
493	0.6
494	0.56
495	0.51
496	0.52
497	0.48
498	0.45
499	0.41
500	0.35
501	0.3
502	0.28
503	0.25
504	0.19
505	0.14
506	0.12
507	0.09
508	0.09
509	0.08
510	0.1
511	0.12
512	0.13
513	0.21
514	0.21
515	0.22
516	0.25
517	0.28
518	0.28
519	0.3
520	0.31
521	0.24
522	0.25
523	0.32
524	0.29
525	0.25
526	0.23
527	0.2
528	0.18
529	0.17
530	0.15
531	0.07
532	0.07
533	0.08
534	0.08
535	0.09
536	0.08
537	0.09
538	0.09
539	0.09
540	0.11
541	0.15
542	0.18
543	0.2
544	0.24
545	0.25
546	0.27
547	0.28
548	0.26
549	0.26
550	0.24
551	0.22
552	0.21
553	0.19
554	0.19
555	0.21
556	0.22
557	0.19
558	0.18
559	0.19
560	0.2
561	0.2
562	0.19
563	0.19
564	0.23
565	0.24
566	0.24
567	0.22
568	0.22
569	0.22
570	0.26
571	0.27
572	0.24
573	0.22
574	0.23
575	0.24
576	0.24
577	0.3
578	0.27
579	0.24
580	0.25
581	0.3
582	0.33
583	0.37
584	0.38
585	0.34
586	0.36
587	0.42
588	0.45
589	0.47
590	0.49
591	0.52
592	0.58
593	0.64
594	0.68
595	0.7
596	0.7
597	0.67
598	0.59
599	0.58
600	0.53
601	0.52
602	0.48
603	0.4
604	0.35
605	0.33
606	0.32
607	0.25
608	0.24
609	0.19
610	0.14
611	0.15
612	0.14
613	0.13
614	0.12
615	0.12
616	0.08
617	0.11
618	0.1
619	0.1
620	0.1
621	0.12
622	0.14
623	0.13
624	0.13
625	0.12
626	0.18
627	0.19
628	0.2
629	0.18
630	0.2
631	0.22
632	0.25
633	0.23
634	0.19
635	0.18
636	0.19
637	0.2
638	0.17
639	0.18
640	0.17
641	0.18
642	0.18
643	0.19
644	0.23
645	0.26
646	0.27
647	0.28
648	0.26
649	0.25
650	0.23
651	0.25
652	0.2
653	0.17
654	0.17
655	0.14
656	0.15
657	0.15
658	0.15
659	0.12
660	0.12
661	0.11
662	0.1
663	0.11
664	0.1
665	0.1
666	0.09
667	0.08
668	0.07
669	0.08
670	0.1
671	0.08
672	0.1
673	0.11
674	0.11
675	0.14
676	0.15
677	0.15
678	0.15
679	0.15
680	0.15
681	0.14
682	0.14
683	0.12
684	0.12
685	0.12
686	0.15
687	0.15
688	0.14
689	0.21
690	0.22
691	0.23
692	0.22
693	0.26
694	0.23
695	0.24
696	0.23
697	0.17
698	0.15
699	0.13
700	0.12
701	0.08
702	0.07
703	0.05
704	0.04
705	0.04
706	0.04
707	0.05
708	0.05
709	0.06
710	0.06
711	0.09
712	0.13
713	0.16
714	0.21
715	0.22
716	0.25
717	0.26
718	0.27
719	0.26
720	0.23

A0A2A9PEC6

3D AlphaFold-predicted Structure Viewer