Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PAH2

Protein Details
Accession A0A2A9PAH2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-64MKKKKKKEEKEKKEKKKKKKKKKKEKKKEKKKEKKKKEKKKEKKKKKKKKKKRHIQPPKAEELLBasic
NLS Segment(s)
PositionSequence
2-57KKKKKKEEKEKKEKKKKKKKKKKEKKKEKKKEKKKKEKKKEKKKKKKKKKKRHIQP
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MKKKKKKEEKEKKEKKKKKKKKKKEKKKEKKKEKKKKEKKKEKKKKKKKKKKRHIQPPKAEELLRMCMGLRSDGLAVMKCQTSVQLWGGAFAFVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.96
5 0.96
6 0.96
7 0.96
8 0.97
9 0.98
10 0.98
11 0.98
12 0.98
13 0.98
14 0.98
15 0.98
16 0.98
17 0.98
18 0.98
19 0.97
20 0.97
21 0.97
22 0.97
23 0.97
24 0.97
25 0.97
26 0.97
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.97
33 0.97
34 0.98
35 0.98
36 0.98
37 0.97
38 0.97
39 0.97
40 0.97
41 0.97
42 0.96
43 0.95
44 0.9
45 0.85
46 0.77
47 0.66
48 0.56
49 0.48
50 0.42
51 0.31
52 0.25
53 0.19
54 0.17
55 0.18
56 0.16
57 0.12
58 0.09
59 0.09
60 0.1
61 0.12
62 0.11
63 0.11
64 0.12
65 0.12
66 0.11
67 0.11
68 0.12
69 0.12
70 0.15
71 0.16
72 0.19
73 0.18
74 0.2
75 0.2