Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PJB2

Protein Details
Accession A0A2A9PJB2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-94PPFPVCRCRYKSKSERCTKGGCRRKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MRFSVFAFVAALVRTINAAPSVPDHTETEAHHPLLSTTAANPQINNHLAAAVSRRREDSRATCFYSCIGPPFPVCRCRYKSKSERCTKGGCRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.1
8 0.13
9 0.13
10 0.16
11 0.16
12 0.17
13 0.19
14 0.2
15 0.25
16 0.24
17 0.23
18 0.21
19 0.2
20 0.18
21 0.17
22 0.17
23 0.1
24 0.07
25 0.11
26 0.15
27 0.15
28 0.15
29 0.14
30 0.18
31 0.18
32 0.18
33 0.14
34 0.1
35 0.1
36 0.1
37 0.13
38 0.12
39 0.13
40 0.14
41 0.16
42 0.17
43 0.19
44 0.25
45 0.27
46 0.32
47 0.35
48 0.39
49 0.37
50 0.36
51 0.35
52 0.32
53 0.27
54 0.22
55 0.19
56 0.16
57 0.18
58 0.22
59 0.26
60 0.31
61 0.33
62 0.39
63 0.43
64 0.52
65 0.57
66 0.62
67 0.68
68 0.72
69 0.8
70 0.82
71 0.84
72 0.79
73 0.83
74 0.82