Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P8E6

Protein Details
Accession A0A2A9P8E6   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-74LFVRRRQRTRLEVKPRRLRRRYNTHREIVIHydrophilic
NLS Segment(s)
PositionSequence
48-65RRRQRTRLEVKPRRLRRR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLRGERRRLSVESSWIGPVRNGFAPGNERGKTVGLKNLCAHSKVLFVRRRQRTRLEVKPRRLRRRYNTHREIVIETCDTQRLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.32
4 0.26
5 0.23
6 0.2
7 0.18
8 0.19
9 0.16
10 0.17
11 0.2
12 0.24
13 0.29
14 0.26
15 0.25
16 0.23
17 0.24
18 0.24
19 0.22
20 0.23
21 0.18
22 0.2
23 0.21
24 0.24
25 0.23
26 0.22
27 0.22
28 0.16
29 0.2
30 0.2
31 0.26
32 0.28
33 0.33
34 0.42
35 0.52
36 0.57
37 0.58
38 0.62
39 0.63
40 0.67
41 0.71
42 0.73
43 0.72
44 0.76
45 0.83
46 0.86
47 0.88
48 0.88
49 0.88
50 0.86
51 0.89
52 0.89
53 0.89
54 0.87
55 0.83
56 0.78
57 0.71
58 0.64
59 0.55
60 0.48
61 0.4
62 0.33
63 0.28