Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P9I5

Protein Details
Accession A0A2A9P9I5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-119IEAIRTKRAKKEEKERYEKIAEKMHRKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
20-36GMRKNGKQWHAPKKAFR
47-115RVKKRAALAQMKAKERDLKEEKEEQRKQRIEAIRTKRAKKEEKERYEKIAEKMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MGAEPALTAISAEKPTKPLGMRKNGKQWHAPKKAFRPTAGLTTYEIRVKKRAALAQMKAKERDLKEEKEEQRKQRIEAIRTKRAKKEEKERYEKIAEKMHRKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.25
4 0.27
5 0.33
6 0.38
7 0.47
8 0.54
9 0.59
10 0.68
11 0.69
12 0.69
13 0.7
14 0.71
15 0.71
16 0.73
17 0.72
18 0.7
19 0.73
20 0.79
21 0.73
22 0.64
23 0.6
24 0.52
25 0.52
26 0.45
27 0.37
28 0.29
29 0.27
30 0.28
31 0.26
32 0.25
33 0.2
34 0.22
35 0.22
36 0.23
37 0.25
38 0.27
39 0.3
40 0.34
41 0.37
42 0.42
43 0.46
44 0.46
45 0.43
46 0.41
47 0.4
48 0.34
49 0.39
50 0.36
51 0.33
52 0.35
53 0.43
54 0.48
55 0.53
56 0.59
57 0.56
58 0.61
59 0.6
60 0.57
61 0.56
62 0.57
63 0.52
64 0.55
65 0.57
66 0.57
67 0.63
68 0.66
69 0.65
70 0.67
71 0.71
72 0.7
73 0.73
74 0.74
75 0.77
76 0.8
77 0.77
78 0.75
79 0.73
80 0.7
81 0.64
82 0.62
83 0.59
84 0.6
85 0.66
86 0.69
87 0.7
88 0.69
89 0.74
90 0.76
91 0.8
92 0.8
93 0.82
94 0.83
95 0.85
96 0.92
97 0.93
98 0.93
99 0.93