Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PKA9

Protein Details
Accession A0A2A9PKA9    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-87VEEKKKCKSAQPTNGIRTKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 8, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTTLHLKPVNNDVRGRLALVTGSTGGIGAACARALAAEGCDVALHYHSSSVKKRSPYSAIRKEEEEGVEEKKKCKSAQPTNGIRTKQKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.28
4 0.21
5 0.17
6 0.15
7 0.14
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.04
33 0.06
34 0.08
35 0.12
36 0.17
37 0.22
38 0.26
39 0.3
40 0.32
41 0.35
42 0.4
43 0.46
44 0.52
45 0.57
46 0.58
47 0.56
48 0.56
49 0.53
50 0.49
51 0.41
52 0.33
53 0.25
54 0.25
55 0.3
56 0.29
57 0.31
58 0.32
59 0.37
60 0.35
61 0.42
62 0.47
63 0.51
64 0.6
65 0.67
66 0.72
67 0.76
68 0.81
69 0.78