Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PGU7

Protein Details
Accession A0A2A9PGU7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
106-128DPEPSPKPSPKPSPKPAQANPESHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, golg 2
Family & Domain DBs
Amino Acid Sequences MKLTATVLLAGAAVVVARNLKYGTCPKTDEVCEIEKQNCCEGSICLKGDSGAAQGICTTCNAVGEDCVPYATATNGPGCCSGLTCSMQFLLPGDRGLCLESDDDSDPEPSPKPSPKPSPKPAQANPESHAHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.05
4 0.05
5 0.07
6 0.07
7 0.08
8 0.13
9 0.21
10 0.25
11 0.27
12 0.31
13 0.33
14 0.38
15 0.4
16 0.38
17 0.34
18 0.33
19 0.32
20 0.32
21 0.33
22 0.3
23 0.31
24 0.31
25 0.27
26 0.25
27 0.23
28 0.21
29 0.22
30 0.23
31 0.22
32 0.19
33 0.18
34 0.17
35 0.17
36 0.15
37 0.11
38 0.08
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.1
69 0.11
70 0.13
71 0.12
72 0.12
73 0.12
74 0.12
75 0.11
76 0.11
77 0.1
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.11
84 0.1
85 0.08
86 0.08
87 0.08
88 0.11
89 0.12
90 0.12
91 0.13
92 0.14
93 0.14
94 0.15
95 0.16
96 0.16
97 0.21
98 0.27
99 0.33
100 0.4
101 0.51
102 0.6
103 0.68
104 0.75
105 0.8
106 0.82
107 0.85
108 0.83
109 0.83
110 0.79
111 0.74
112 0.68