Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P2Q0

Protein Details
Accession A0A2A9P2Q0   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-46ILKHRHPSKSRRLHDRRASLBasic
NLS Segment(s)
PositionSequence
29-38KHRHPSKSRR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGNYLEESPNTLSPEAPTLPAFSPKGILKHRHPSKSRRLHDRRASLLTILKAEVENQIMLHEEWRVAIESIKVDVNIRSWSECEEWNMVEGEKKIVNFTLDIKAVTEGLGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.19
4 0.17
5 0.17
6 0.18
7 0.23
8 0.22
9 0.18
10 0.21
11 0.22
12 0.28
13 0.32
14 0.37
15 0.39
16 0.49
17 0.57
18 0.63
19 0.67
20 0.69
21 0.73
22 0.77
23 0.78
24 0.78
25 0.78
26 0.79
27 0.81
28 0.79
29 0.73
30 0.66
31 0.6
32 0.5
33 0.45
34 0.35
35 0.27
36 0.2
37 0.15
38 0.11
39 0.11
40 0.1
41 0.08
42 0.07
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.06
52 0.07
53 0.06
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.09
62 0.11
63 0.12
64 0.13
65 0.12
66 0.13
67 0.15
68 0.16
69 0.17
70 0.18
71 0.18
72 0.17
73 0.17
74 0.18
75 0.15
76 0.17
77 0.16
78 0.16
79 0.16
80 0.16
81 0.16
82 0.16
83 0.17
84 0.15
85 0.18
86 0.2
87 0.2
88 0.2
89 0.2
90 0.19
91 0.18