Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PCW2

Protein Details
Accession A0A2A9PCW2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
147-170LHLCVLKKTTRRPRREPAWREGRSHydrophilic
NLS Segment(s)
PositionSequence
156-167TRRPRREPAWRE
Subcellular Location(s) extr 13, plas 10, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences MVAFGCFVVSFLAAWAFAGSEPDSGSLLGLDQTTTYICRAGKRNHGPLYGEIGKDYAIASLLSANTTTGASGYPKPFDNSGNVLRFGRGCSHHHLWELPVLADNRPFRIHLKESESNRAGPMRVYYTRHLRFCGVAAKLSPHATGALHLCVLKKTTRRPRREPAWREGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.08
6 0.08
7 0.08
8 0.09
9 0.09
10 0.1
11 0.09
12 0.09
13 0.07
14 0.07
15 0.07
16 0.07
17 0.06
18 0.05
19 0.06
20 0.06
21 0.07
22 0.08
23 0.1
24 0.11
25 0.16
26 0.24
27 0.29
28 0.39
29 0.46
30 0.55
31 0.56
32 0.58
33 0.55
34 0.49
35 0.52
36 0.45
37 0.36
38 0.28
39 0.23
40 0.2
41 0.18
42 0.16
43 0.08
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.06
54 0.05
55 0.04
56 0.05
57 0.07
58 0.1
59 0.11
60 0.12
61 0.13
62 0.15
63 0.16
64 0.16
65 0.17
66 0.18
67 0.22
68 0.22
69 0.23
70 0.22
71 0.21
72 0.2
73 0.18
74 0.17
75 0.15
76 0.16
77 0.22
78 0.25
79 0.26
80 0.27
81 0.26
82 0.23
83 0.23
84 0.21
85 0.14
86 0.14
87 0.13
88 0.13
89 0.17
90 0.17
91 0.16
92 0.16
93 0.18
94 0.17
95 0.22
96 0.24
97 0.24
98 0.32
99 0.37
100 0.4
101 0.47
102 0.47
103 0.42
104 0.4
105 0.37
106 0.29
107 0.23
108 0.22
109 0.19
110 0.22
111 0.25
112 0.28
113 0.37
114 0.43
115 0.44
116 0.44
117 0.4
118 0.37
119 0.36
120 0.37
121 0.28
122 0.24
123 0.23
124 0.24
125 0.25
126 0.26
127 0.23
128 0.17
129 0.17
130 0.15
131 0.16
132 0.15
133 0.14
134 0.14
135 0.15
136 0.15
137 0.16
138 0.18
139 0.22
140 0.26
141 0.35
142 0.46
143 0.55
144 0.64
145 0.71
146 0.79
147 0.84
148 0.89
149 0.86
150 0.85