Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PI96

Protein Details
Accession A0A2A9PI96    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-32LGRLPRSLPPAHRRRRRRFFFSSFSSHydrophilic
NLS Segment(s)
PositionSequence
14-24LPPAHRRRRRR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002634  BolA  
IPR036065  BolA-like_sf  
Pfam View protein in Pfam  
PF01722  BolA  
Amino Acid Sequences MLRSLALGRLPRSLPPAHRRRRRRFFFSSFSSSSSPPPAADNDDVSPSVTTAAERSITSILTSKLSPTKLLVQDVSGGCGTMYAIHVTSPLFRGQSLLQQQRMVNGALGDLVKAWHGLHLRTSVPKDDGALKDETRRPTVTSSYRREHQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.54
4 0.6
5 0.69
6 0.78
7 0.84
8 0.9
9 0.9
10 0.88
11 0.87
12 0.84
13 0.82
14 0.78
15 0.75
16 0.66
17 0.6
18 0.54
19 0.45
20 0.4
21 0.36
22 0.29
23 0.21
24 0.21
25 0.19
26 0.21
27 0.22
28 0.22
29 0.19
30 0.2
31 0.2
32 0.19
33 0.17
34 0.12
35 0.11
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.11
50 0.11
51 0.14
52 0.14
53 0.14
54 0.14
55 0.19
56 0.2
57 0.21
58 0.2
59 0.16
60 0.2
61 0.19
62 0.19
63 0.13
64 0.11
65 0.09
66 0.09
67 0.08
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.06
76 0.07
77 0.08
78 0.08
79 0.08
80 0.09
81 0.1
82 0.16
83 0.24
84 0.28
85 0.28
86 0.31
87 0.31
88 0.31
89 0.32
90 0.26
91 0.19
92 0.13
93 0.12
94 0.1
95 0.09
96 0.08
97 0.06
98 0.06
99 0.05
100 0.06
101 0.06
102 0.09
103 0.1
104 0.11
105 0.14
106 0.16
107 0.19
108 0.23
109 0.26
110 0.26
111 0.26
112 0.26
113 0.26
114 0.3
115 0.29
116 0.28
117 0.29
118 0.27
119 0.33
120 0.38
121 0.41
122 0.39
123 0.39
124 0.37
125 0.38
126 0.45
127 0.47
128 0.51
129 0.54
130 0.57