Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P393

Protein Details
Accession A0A2A9P393    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-81LRAVPKKKTSHSKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
63-75PKKKTSHSKKRHR
Subcellular Location(s) mito 13.5, cyto_mito 9, extr 5, cyto 3.5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAAAAVLAPLAPRLALASLISSPLRWPAIVWPRPLAGFGFPSISLNLPTLDDIWESVLRAVPKKKTSHSKKRHRQMAGKALEDVHGLCDCPGCGERKRTHRICQKCLDDMRRIWREDTPEFKPFETPVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.07
5 0.08
6 0.08
7 0.11
8 0.11
9 0.1
10 0.1
11 0.13
12 0.14
13 0.12
14 0.12
15 0.19
16 0.29
17 0.33
18 0.35
19 0.33
20 0.33
21 0.34
22 0.34
23 0.26
24 0.17
25 0.14
26 0.13
27 0.12
28 0.11
29 0.12
30 0.12
31 0.11
32 0.1
33 0.1
34 0.1
35 0.08
36 0.09
37 0.08
38 0.08
39 0.07
40 0.07
41 0.08
42 0.08
43 0.07
44 0.07
45 0.09
46 0.09
47 0.12
48 0.16
49 0.19
50 0.24
51 0.26
52 0.32
53 0.4
54 0.5
55 0.58
56 0.65
57 0.72
58 0.77
59 0.84
60 0.88
61 0.84
62 0.82
63 0.8
64 0.79
65 0.72
66 0.63
67 0.54
68 0.45
69 0.39
70 0.31
71 0.22
72 0.14
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.09
79 0.1
80 0.13
81 0.17
82 0.24
83 0.32
84 0.4
85 0.51
86 0.54
87 0.63
88 0.69
89 0.74
90 0.74
91 0.76
92 0.73
93 0.71
94 0.74
95 0.7
96 0.67
97 0.63
98 0.66
99 0.62
100 0.59
101 0.53
102 0.49
103 0.5
104 0.5
105 0.51
106 0.47
107 0.47
108 0.47
109 0.45
110 0.44