Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NXY4

Protein Details
Accession A0A2A9NXY4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKSSSKPMGPRKADPLBasic
NLS Segment(s)
PositionSequence
3-15KRKKSSSKPMGPR
Subcellular Location(s) mito 16, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSSKPMGPRKADPLPTTFTCLFCNHEKSVNVKLDRKAGVGQLDCRVCGQKFQCAVNYLSAAVDVYGEWVDAADAVAKQDTSEPRTYESVVHTPGFEKRQRGLKDPGRDVDEDVDALEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.71
5 0.62
6 0.55
7 0.51
8 0.47
9 0.48
10 0.42
11 0.35
12 0.31
13 0.3
14 0.3
15 0.29
16 0.33
17 0.28
18 0.31
19 0.32
20 0.33
21 0.39
22 0.43
23 0.42
24 0.42
25 0.43
26 0.43
27 0.42
28 0.4
29 0.33
30 0.28
31 0.28
32 0.24
33 0.24
34 0.24
35 0.23
36 0.22
37 0.21
38 0.21
39 0.17
40 0.2
41 0.19
42 0.2
43 0.22
44 0.23
45 0.24
46 0.24
47 0.25
48 0.21
49 0.2
50 0.15
51 0.12
52 0.11
53 0.08
54 0.06
55 0.05
56 0.03
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.05
69 0.05
70 0.05
71 0.09
72 0.12
73 0.16
74 0.19
75 0.2
76 0.23
77 0.25
78 0.26
79 0.24
80 0.26
81 0.25
82 0.25
83 0.24
84 0.22
85 0.22
86 0.26
87 0.31
88 0.3
89 0.3
90 0.32
91 0.41
92 0.45
93 0.49
94 0.54
95 0.56
96 0.62
97 0.65
98 0.65
99 0.6
100 0.57
101 0.53
102 0.46
103 0.39
104 0.29