Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9P4G4

Protein Details
Accession A0A2A9P4G4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-34TARPSTRTYHHKTKGNKEEKPNPQDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MPSKSQKQTARPSTRTYHHKTKGNKEEKPNPQDEATRKEANKPGYGAGGRRRFLYGLSTSQQPEPKGVPTGVCHSVGQGKEEICLGDECGRKVVSTPQPDDSSSSSKLSAPLGPDWTRQPQFDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.7
4 0.7
5 0.68
6 0.72
7 0.75
8 0.78
9 0.81
10 0.81
11 0.8
12 0.79
13 0.81
14 0.83
15 0.82
16 0.74
17 0.66
18 0.59
19 0.58
20 0.53
21 0.49
22 0.45
23 0.44
24 0.42
25 0.45
26 0.48
27 0.44
28 0.42
29 0.37
30 0.32
31 0.29
32 0.3
33 0.27
34 0.3
35 0.33
36 0.31
37 0.31
38 0.31
39 0.27
40 0.26
41 0.26
42 0.2
43 0.17
44 0.18
45 0.19
46 0.2
47 0.22
48 0.24
49 0.2
50 0.2
51 0.17
52 0.17
53 0.17
54 0.16
55 0.14
56 0.13
57 0.17
58 0.18
59 0.18
60 0.16
61 0.15
62 0.19
63 0.19
64 0.18
65 0.16
66 0.14
67 0.13
68 0.14
69 0.13
70 0.1
71 0.1
72 0.1
73 0.14
74 0.16
75 0.16
76 0.18
77 0.18
78 0.17
79 0.18
80 0.25
81 0.27
82 0.32
83 0.34
84 0.38
85 0.4
86 0.41
87 0.43
88 0.38
89 0.35
90 0.31
91 0.3
92 0.25
93 0.24
94 0.25
95 0.24
96 0.23
97 0.21
98 0.22
99 0.27
100 0.28
101 0.3
102 0.34
103 0.41
104 0.42