Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9P4R3

Protein Details
Accession A0A2A9P4R3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRLPFSRKKEKKKSDASSPYPDDHydrophilic
NLS Segment(s)
PositionSequence
8-13KKEKKK
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001810  F-box_dom  
IPR032675  LRR_dom_sf  
Pfam View protein in Pfam  
PF12937  F-box-like  
Amino Acid Sequences MRLPFSRKKEKKKSDASSPYPDDLRPWEPPRFPPTRASAQLLAHLPRVVLQRIFVYICPHSRDESYETCEESASDSGCMLCDLRDLSHCAQVSRTWRASAITVMYHSVRIDPVHYCKLEAFLAEKRKKTSRFDRNGIPEDPALARLRLFRRTVRDDPTRIGKLVQFLKTPYMIRESCHVELAQTIAVLPNLQYVDLPEGMFADEPNYATLRLEVQARCPDLRKMTYVRGSESSFANLATGRVWPRLEVLELDRVDVDPMVLRTALASLTRLRALKVSETPSFSDEVMAADDGLPPLPALEELIVKDAPRMTTAGLVEYLSCRHDSRTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.87
4 0.85
5 0.8
6 0.74
7 0.65
8 0.57
9 0.49
10 0.45
11 0.42
12 0.41
13 0.41
14 0.44
15 0.46
16 0.52
17 0.57
18 0.56
19 0.54
20 0.52
21 0.54
22 0.55
23 0.56
24 0.54
25 0.51
26 0.46
27 0.49
28 0.47
29 0.41
30 0.34
31 0.3
32 0.25
33 0.24
34 0.27
35 0.24
36 0.2
37 0.2
38 0.19
39 0.21
40 0.23
41 0.2
42 0.2
43 0.21
44 0.25
45 0.27
46 0.28
47 0.28
48 0.27
49 0.3
50 0.31
51 0.31
52 0.33
53 0.31
54 0.31
55 0.28
56 0.27
57 0.24
58 0.21
59 0.18
60 0.13
61 0.11
62 0.1
63 0.1
64 0.1
65 0.1
66 0.08
67 0.06
68 0.07
69 0.08
70 0.08
71 0.1
72 0.15
73 0.16
74 0.21
75 0.22
76 0.21
77 0.21
78 0.24
79 0.28
80 0.3
81 0.3
82 0.25
83 0.26
84 0.26
85 0.26
86 0.24
87 0.2
88 0.14
89 0.13
90 0.14
91 0.13
92 0.13
93 0.12
94 0.11
95 0.11
96 0.1
97 0.11
98 0.13
99 0.17
100 0.21
101 0.21
102 0.21
103 0.2
104 0.22
105 0.21
106 0.18
107 0.16
108 0.17
109 0.27
110 0.31
111 0.33
112 0.35
113 0.42
114 0.46
115 0.51
116 0.56
117 0.57
118 0.61
119 0.63
120 0.67
121 0.67
122 0.67
123 0.6
124 0.51
125 0.4
126 0.33
127 0.29
128 0.24
129 0.17
130 0.12
131 0.12
132 0.15
133 0.18
134 0.21
135 0.23
136 0.24
137 0.3
138 0.37
139 0.41
140 0.43
141 0.46
142 0.44
143 0.44
144 0.47
145 0.42
146 0.35
147 0.32
148 0.26
149 0.25
150 0.27
151 0.26
152 0.21
153 0.2
154 0.21
155 0.22
156 0.21
157 0.17
158 0.18
159 0.16
160 0.16
161 0.19
162 0.23
163 0.22
164 0.22
165 0.21
166 0.16
167 0.15
168 0.16
169 0.12
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.08
182 0.09
183 0.09
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.08
198 0.09
199 0.13
200 0.13
201 0.17
202 0.21
203 0.23
204 0.24
205 0.25
206 0.28
207 0.28
208 0.29
209 0.29
210 0.28
211 0.33
212 0.38
213 0.38
214 0.37
215 0.36
216 0.35
217 0.33
218 0.3
219 0.25
220 0.19
221 0.17
222 0.14
223 0.11
224 0.1
225 0.09
226 0.11
227 0.11
228 0.14
229 0.14
230 0.14
231 0.15
232 0.16
233 0.17
234 0.15
235 0.16
236 0.21
237 0.21
238 0.21
239 0.2
240 0.18
241 0.18
242 0.16
243 0.13
244 0.08
245 0.09
246 0.09
247 0.09
248 0.08
249 0.08
250 0.09
251 0.09
252 0.07
253 0.09
254 0.1
255 0.12
256 0.16
257 0.17
258 0.17
259 0.19
260 0.21
261 0.24
262 0.28
263 0.31
264 0.31
265 0.34
266 0.35
267 0.34
268 0.33
269 0.28
270 0.23
271 0.17
272 0.15
273 0.13
274 0.11
275 0.1
276 0.09
277 0.09
278 0.09
279 0.09
280 0.08
281 0.06
282 0.06
283 0.06
284 0.06
285 0.06
286 0.07
287 0.09
288 0.09
289 0.13
290 0.14
291 0.13
292 0.16
293 0.17
294 0.17
295 0.16
296 0.17
297 0.14
298 0.18
299 0.19
300 0.18
301 0.17
302 0.16
303 0.16
304 0.16
305 0.17
306 0.15
307 0.17
308 0.16