Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PJK7

Protein Details
Accession A0A2A9PJK7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-122GYLTRLRTKNGRKILARRRAKGRKELSAHydrophilic
NLS Segment(s)
PositionSequence
91-119KRRHGYLTRLRTKNGRKILARRRAKGRKE
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MRLLSVTLTRPFLARPSPSLSPRCFSTLIPHRPTLALPTRMPIGAGFSPPASVADVVVPSNAVSSHPALAGLQLRFGPRNTMVRATRLVQKRRHGYLTRLRTKNGRKILARRRAKGRKELSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.36
5 0.41
6 0.47
7 0.46
8 0.43
9 0.43
10 0.43
11 0.38
12 0.32
13 0.36
14 0.4
15 0.46
16 0.47
17 0.45
18 0.43
19 0.42
20 0.42
21 0.39
22 0.36
23 0.31
24 0.27
25 0.28
26 0.28
27 0.27
28 0.27
29 0.2
30 0.17
31 0.12
32 0.13
33 0.12
34 0.1
35 0.11
36 0.1
37 0.11
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.04
47 0.05
48 0.04
49 0.04
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.08
57 0.11
58 0.09
59 0.1
60 0.1
61 0.11
62 0.13
63 0.13
64 0.15
65 0.14
66 0.19
67 0.21
68 0.26
69 0.27
70 0.28
71 0.31
72 0.3
73 0.35
74 0.39
75 0.45
76 0.45
77 0.53
78 0.58
79 0.6
80 0.66
81 0.62
82 0.62
83 0.64
84 0.68
85 0.69
86 0.65
87 0.63
88 0.64
89 0.7
90 0.71
91 0.7
92 0.67
93 0.65
94 0.73
95 0.8
96 0.81
97 0.82
98 0.8
99 0.82
100 0.84
101 0.84
102 0.84