Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PF06

Protein Details
Accession A0A2A9PF06   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-45HEGSVFRRRRLRFRRSRRPGSAVQBasic
NLS Segment(s)
PositionSequence
28-40RRRRLRFRRSRRP
Subcellular Location(s) mito 23, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
Amino Acid Sequences MRSMRRLADRANPEFLAASASHEGSVFRRRRLRFRRSRRPGSAVQSVVEPASAAGQRAQHPGKPGGEVLAKERCDGGFVGLTGAILDLWRRVRLFVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.26
4 0.17
5 0.17
6 0.13
7 0.13
8 0.13
9 0.13
10 0.13
11 0.14
12 0.23
13 0.23
14 0.28
15 0.36
16 0.39
17 0.5
18 0.59
19 0.67
20 0.69
21 0.76
22 0.82
23 0.84
24 0.9
25 0.85
26 0.82
27 0.77
28 0.72
29 0.67
30 0.57
31 0.47
32 0.37
33 0.31
34 0.25
35 0.18
36 0.12
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.09
43 0.11
44 0.17
45 0.18
46 0.18
47 0.21
48 0.25
49 0.24
50 0.23
51 0.21
52 0.19
53 0.2
54 0.19
55 0.2
56 0.23
57 0.23
58 0.22
59 0.23
60 0.2
61 0.19
62 0.18
63 0.16
64 0.12
65 0.11
66 0.12
67 0.11
68 0.11
69 0.09
70 0.09
71 0.06
72 0.05
73 0.05
74 0.09
75 0.11
76 0.15
77 0.15