Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PBE0

Protein Details
Accession A0A2A9PBE0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-32LPPLKVLRVHTPKRKPENPCVAIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSSGRNSMRLPPLKVLRVHTPKRKPENPCVAIMSSVLACWASAGFTAAGCAVLETQLRQCMDGPPPPAAATNTINYHLGRMKKYLINKGKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.54
4 0.58
5 0.63
6 0.65
7 0.68
8 0.72
9 0.79
10 0.82
11 0.78
12 0.79
13 0.81
14 0.74
15 0.67
16 0.6
17 0.5
18 0.43
19 0.36
20 0.26
21 0.15
22 0.11
23 0.09
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.05
42 0.06
43 0.1
44 0.1
45 0.11
46 0.12
47 0.14
48 0.17
49 0.21
50 0.22
51 0.2
52 0.21
53 0.21
54 0.21
55 0.19
56 0.2
57 0.18
58 0.2
59 0.2
60 0.21
61 0.23
62 0.21
63 0.23
64 0.24
65 0.26
66 0.25
67 0.26
68 0.3
69 0.34
70 0.41
71 0.48
72 0.53