Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PEM2

Protein Details
Accession A0A2A9PEM2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSNRKKAFKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-89NRKKAFKAKAAAKKKA
Subcellular Location(s) plas 19, E.R. 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKLLGLAMLVAASVVFIYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVILVLLASAVVGSFLGTVMIRSNRKKAFKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.1
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.11
28 0.11
29 0.09
30 0.09
31 0.11
32 0.12
33 0.11
34 0.11
35 0.12
36 0.11
37 0.11
38 0.11
39 0.09
40 0.08
41 0.06
42 0.05
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.04
56 0.07
57 0.13
58 0.19
59 0.23
60 0.31
61 0.39
62 0.45
63 0.52
64 0.58
65 0.63
66 0.66
67 0.72
68 0.75
69 0.78