Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9P2Q9

Protein Details
Accession A0A2A9P2Q9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-66LLTEWVVKKKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKESRRSLEEQBasic
NLS Segment(s)
PositionSequence
16-61KKKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKESRR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MESCFDLGLLTEWVVKKKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKKEKESRRSLEEQVAINM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.33
4 0.42
5 0.52
6 0.6
7 0.7
8 0.75
9 0.83
10 0.91
11 0.92
12 0.95
13 0.95
14 0.95
15 0.95
16 0.94
17 0.94
18 0.94
19 0.93
20 0.92
21 0.94
22 0.93
23 0.92
24 0.94
25 0.93
26 0.92
27 0.94
28 0.93
29 0.92
30 0.94
31 0.93
32 0.92
33 0.94
34 0.93
35 0.92
36 0.94
37 0.93
38 0.92
39 0.94
40 0.93
41 0.92
42 0.93
43 0.92
44 0.91
45 0.92
46 0.87
47 0.83
48 0.79
49 0.72
50 0.69
51 0.63