Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9PN18

Protein Details
Accession A0A2A9PN18    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
165-190RETSSEDRPQEKRRRRQADSSGERYCHydrophilic
NLS Segment(s)
PositionSequence
126-150RRRRHRDTAREEEPKEKRQREEKPP
161-165LRRHR
172-180RPQEKRRRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTSSLSYRPQPATLSPSSSDFSSIEPASSSNSPSPTPPPPPPHPSPRHVKTLPALRPGRPADNRRRVSRYEGGDSDSDSDGHHVSGASVGLLLSLSSPGMTRRPVLPSGSATSSPRSDDGATVFPRRRRHRDTAREEEPKEKRQREEKPPGDNDTPVASRLRRHRETSSEDRPQEKRRRRQADSSGERYCDCVRETCYRQNGTPISSDEIVYTVEGDEMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.33
4 0.32
5 0.29
6 0.28
7 0.22
8 0.21
9 0.22
10 0.2
11 0.17
12 0.16
13 0.16
14 0.18
15 0.19
16 0.2
17 0.18
18 0.2
19 0.21
20 0.23
21 0.28
22 0.29
23 0.35
24 0.39
25 0.44
26 0.49
27 0.56
28 0.61
29 0.66
30 0.66
31 0.67
32 0.69
33 0.66
34 0.68
35 0.61
36 0.58
37 0.55
38 0.58
39 0.56
40 0.56
41 0.54
42 0.46
43 0.53
44 0.52
45 0.53
46 0.51
47 0.55
48 0.56
49 0.64
50 0.68
51 0.67
52 0.68
53 0.62
54 0.62
55 0.61
56 0.55
57 0.5
58 0.45
59 0.41
60 0.37
61 0.35
62 0.3
63 0.23
64 0.18
65 0.12
66 0.12
67 0.1
68 0.09
69 0.09
70 0.06
71 0.06
72 0.06
73 0.06
74 0.04
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.06
87 0.07
88 0.09
89 0.1
90 0.13
91 0.15
92 0.16
93 0.16
94 0.17
95 0.18
96 0.19
97 0.18
98 0.16
99 0.17
100 0.16
101 0.15
102 0.14
103 0.13
104 0.12
105 0.11
106 0.12
107 0.15
108 0.16
109 0.2
110 0.24
111 0.27
112 0.35
113 0.42
114 0.49
115 0.51
116 0.59
117 0.66
118 0.73
119 0.77
120 0.78
121 0.79
122 0.78
123 0.72
124 0.71
125 0.66
126 0.64
127 0.65
128 0.6
129 0.58
130 0.6
131 0.67
132 0.69
133 0.74
134 0.72
135 0.71
136 0.71
137 0.71
138 0.64
139 0.55
140 0.46
141 0.39
142 0.33
143 0.25
144 0.24
145 0.19
146 0.22
147 0.31
148 0.39
149 0.4
150 0.45
151 0.49
152 0.52
153 0.6
154 0.63
155 0.64
156 0.64
157 0.62
158 0.64
159 0.65
160 0.68
161 0.7
162 0.71
163 0.72
164 0.74
165 0.8
166 0.8
167 0.84
168 0.84
169 0.84
170 0.83
171 0.8
172 0.74
173 0.66
174 0.6
175 0.54
176 0.45
177 0.37
178 0.3
179 0.27
180 0.27
181 0.35
182 0.4
183 0.45
184 0.52
185 0.52
186 0.52
187 0.56
188 0.54
189 0.47
190 0.45
191 0.39
192 0.37
193 0.34
194 0.33
195 0.25
196 0.22
197 0.21
198 0.16
199 0.14
200 0.09