Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9PD14

Protein Details
Accession A0A2A9PD14    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-49DEFSKSKKTRREAAKRQKALHydrophilic
90-109KQAMRKERKAKIKESNYLKSHydrophilic
NLS Segment(s)
PositionSequence
35-46SKKTRREAAKRQ
95-99KERKA
Subcellular Location(s) nucl 13, cyto 6, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MKDSDYPEWLWSCLDVIKTKSDESGGDDGDEFSKSKKTRREAAKRQKALGTTGPMAPKIPVQHQSVNLPGHEGGSVEDNIFAADMRAELKQAMRKERKAKIKESNYLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.23
5 0.24
6 0.24
7 0.24
8 0.23
9 0.21
10 0.22
11 0.23
12 0.19
13 0.17
14 0.17
15 0.17
16 0.16
17 0.16
18 0.11
19 0.09
20 0.16
21 0.17
22 0.23
23 0.3
24 0.35
25 0.43
26 0.53
27 0.63
28 0.68
29 0.78
30 0.82
31 0.78
32 0.75
33 0.69
34 0.59
35 0.51
36 0.43
37 0.35
38 0.26
39 0.25
40 0.23
41 0.2
42 0.19
43 0.16
44 0.14
45 0.13
46 0.14
47 0.17
48 0.2
49 0.23
50 0.24
51 0.26
52 0.29
53 0.28
54 0.25
55 0.22
56 0.18
57 0.15
58 0.13
59 0.12
60 0.08
61 0.09
62 0.09
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.06
69 0.04
70 0.04
71 0.04
72 0.05
73 0.06
74 0.06
75 0.07
76 0.11
77 0.17
78 0.23
79 0.33
80 0.4
81 0.49
82 0.57
83 0.66
84 0.72
85 0.73
86 0.77
87 0.78
88 0.79
89 0.8
90 0.8