Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VI35

Protein Details
Accession A0A0L6VI35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-23SQVERRLKSGRSRNDQKSCTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences IYSQVERRLKSGRSRNDQKSCTKLLTSWLKLNHCWGILKETPKWKETQQEHKLKAKKTNTLKDSSKDQSRLLPTDITNPSSPPPQEELAVENKKDKENHSLLFCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.82
4 0.82
5 0.79
6 0.76
7 0.7
8 0.62
9 0.54
10 0.44
11 0.43
12 0.46
13 0.43
14 0.42
15 0.43
16 0.43
17 0.42
18 0.45
19 0.39
20 0.3
21 0.28
22 0.23
23 0.24
24 0.25
25 0.28
26 0.29
27 0.35
28 0.36
29 0.36
30 0.37
31 0.33
32 0.39
33 0.42
34 0.48
35 0.5
36 0.56
37 0.59
38 0.64
39 0.68
40 0.62
41 0.64
42 0.57
43 0.56
44 0.56
45 0.61
46 0.57
47 0.58
48 0.58
49 0.53
50 0.55
51 0.52
52 0.5
53 0.43
54 0.41
55 0.39
56 0.4
57 0.4
58 0.35
59 0.32
60 0.26
61 0.31
62 0.32
63 0.3
64 0.26
65 0.25
66 0.25
67 0.27
68 0.27
69 0.23
70 0.25
71 0.23
72 0.23
73 0.23
74 0.24
75 0.29
76 0.33
77 0.31
78 0.33
79 0.34
80 0.38
81 0.41
82 0.41
83 0.41
84 0.42
85 0.47