Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6U916

Protein Details
Accession A0A0L6U916    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31RYFGSFKGTLKQKRNFKRPYLSRNTSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences HQFHKRYFGSFKGTLKQKRNFKRPYLSRNTSTVMLEELLFQGKMNPDLGNSEEVYSLTYAYKEGLKLVQNYYYDVSLHGSVFIPIFIPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.68
4 0.7
5 0.75
6 0.81
7 0.8
8 0.79
9 0.81
10 0.81
11 0.83
12 0.83
13 0.79
14 0.72
15 0.68
16 0.62
17 0.53
18 0.44
19 0.34
20 0.24
21 0.18
22 0.15
23 0.11
24 0.09
25 0.08
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.09
35 0.1
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.1
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.12
52 0.15
53 0.17
54 0.19
55 0.23
56 0.23
57 0.25
58 0.25
59 0.23
60 0.19
61 0.18
62 0.19
63 0.15
64 0.15
65 0.14
66 0.12
67 0.12
68 0.12
69 0.11