Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6U8K4

Protein Details
Accession A0A0L6U8K4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22SAPNAWPRRRRSDKLRPASMPSHydrophilic
32-55PLPHPTPTLRRHLRRRCQGPFPTDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 14, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR032567  LDOC1-rel  
IPR005162  Retrotrans_gag_dom  
Pfam View protein in Pfam  
PF03732  Retrotrans_gag  
Amino Acid Sequences SAPNAWPRRRRSDKLRPASMPSNTPPPLNQIPLPHPTPTLRRHLRRRCQGPFPTDASKVAFAASFMQDYAATWCQPYLNQIFNGELLDWTDFLKYMEASFFDHNRHHQAKVALRNIRQTRSASNYTQDFNQHSRTTGWPDALLMSLYQNGLKENFQLAVLMSNIQFDSPVHARDGPESGPDHRRHPTSPPHPPSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.81
4 0.78
5 0.77
6 0.71
7 0.65
8 0.58
9 0.57
10 0.49
11 0.46
12 0.39
13 0.39
14 0.39
15 0.37
16 0.35
17 0.32
18 0.35
19 0.39
20 0.41
21 0.35
22 0.33
23 0.33
24 0.37
25 0.37
26 0.43
27 0.47
28 0.54
29 0.64
30 0.72
31 0.79
32 0.83
33 0.87
34 0.83
35 0.84
36 0.81
37 0.75
38 0.7
39 0.65
40 0.58
41 0.5
42 0.45
43 0.37
44 0.31
45 0.26
46 0.21
47 0.15
48 0.11
49 0.12
50 0.11
51 0.09
52 0.08
53 0.08
54 0.08
55 0.08
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.13
64 0.13
65 0.14
66 0.14
67 0.15
68 0.15
69 0.15
70 0.15
71 0.12
72 0.09
73 0.07
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.06
81 0.05
82 0.05
83 0.05
84 0.06
85 0.08
86 0.09
87 0.11
88 0.12
89 0.14
90 0.15
91 0.22
92 0.24
93 0.22
94 0.24
95 0.27
96 0.32
97 0.38
98 0.43
99 0.4
100 0.4
101 0.48
102 0.48
103 0.45
104 0.42
105 0.36
106 0.34
107 0.35
108 0.39
109 0.31
110 0.32
111 0.32
112 0.3
113 0.3
114 0.29
115 0.26
116 0.25
117 0.28
118 0.25
119 0.24
120 0.25
121 0.26
122 0.3
123 0.28
124 0.26
125 0.21
126 0.2
127 0.19
128 0.18
129 0.15
130 0.09
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.09
137 0.1
138 0.11
139 0.11
140 0.12
141 0.12
142 0.11
143 0.11
144 0.1
145 0.11
146 0.1
147 0.1
148 0.09
149 0.1
150 0.09
151 0.09
152 0.09
153 0.07
154 0.14
155 0.15
156 0.16
157 0.18
158 0.2
159 0.21
160 0.23
161 0.26
162 0.2
163 0.21
164 0.23
165 0.25
166 0.32
167 0.34
168 0.37
169 0.41
170 0.44
171 0.43
172 0.48
173 0.54
174 0.56
175 0.64
176 0.68