Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VSI3

Protein Details
Accession A0A0L6VSI3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
26-49AKYPNRYCKAPKPFKKQHNALKAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYNLGWQKGYEEASKICITGIAAKIAKYPNRYCKAPKPFKKQHNALKAPELEPSFKEDPGHQSLENEMPNNTSKGKIRASNYQNINPKSRATPKEASNPFKSDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.19
4 0.16
5 0.15
6 0.17
7 0.18
8 0.19
9 0.19
10 0.19
11 0.23
12 0.27
13 0.3
14 0.31
15 0.37
16 0.41
17 0.46
18 0.5
19 0.52
20 0.58
21 0.65
22 0.69
23 0.72
24 0.73
25 0.77
26 0.83
27 0.86
28 0.85
29 0.83
30 0.83
31 0.78
32 0.7
33 0.66
34 0.59
35 0.49
36 0.44
37 0.36
38 0.26
39 0.21
40 0.25
41 0.21
42 0.19
43 0.19
44 0.16
45 0.2
46 0.23
47 0.25
48 0.19
49 0.18
50 0.2
51 0.23
52 0.23
53 0.18
54 0.15
55 0.14
56 0.16
57 0.17
58 0.16
59 0.15
60 0.17
61 0.22
62 0.27
63 0.3
64 0.33
65 0.41
66 0.46
67 0.51
68 0.54
69 0.57
70 0.61
71 0.59
72 0.61
73 0.53
74 0.5
75 0.49
76 0.53
77 0.5
78 0.48
79 0.52
80 0.52
81 0.6
82 0.66
83 0.66
84 0.62