Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V1J0

Protein Details
Accession A0A0L6V1J0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-46KLMKVKMNPKKSKFPNPIREVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 8.5, mito 7
Family & Domain DBs
Amino Acid Sequences MEISPALEGTQPTKSIIPSHLNQSLKLMKVKMNPKKSKFPNPIREVGFGITLRTLLMGTGSHLPVVHGGGQVCKAQLAKDQSGSTKNIHGHLLQLLKKTKQISHMDLKKWMESGLLNPMVSLGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.28
5 0.27
6 0.32
7 0.37
8 0.37
9 0.36
10 0.39
11 0.38
12 0.35
13 0.37
14 0.32
15 0.29
16 0.36
17 0.46
18 0.49
19 0.56
20 0.62
21 0.64
22 0.73
23 0.76
24 0.79
25 0.8
26 0.81
27 0.8
28 0.77
29 0.77
30 0.7
31 0.64
32 0.54
33 0.44
34 0.36
35 0.26
36 0.21
37 0.14
38 0.11
39 0.09
40 0.07
41 0.06
42 0.04
43 0.04
44 0.04
45 0.05
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.07
54 0.06
55 0.07
56 0.07
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.13
64 0.17
65 0.17
66 0.2
67 0.21
68 0.22
69 0.25
70 0.27
71 0.24
72 0.24
73 0.24
74 0.23
75 0.24
76 0.21
77 0.2
78 0.22
79 0.26
80 0.24
81 0.28
82 0.31
83 0.31
84 0.35
85 0.36
86 0.35
87 0.38
88 0.42
89 0.43
90 0.49
91 0.56
92 0.55
93 0.6
94 0.6
95 0.53
96 0.47
97 0.4
98 0.31
99 0.24
100 0.24
101 0.25
102 0.25
103 0.23
104 0.22