Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UYI7

Protein Details
Accession A0A0L6UYI7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-43VRSLNRKKVNFTKNRKRNSKRPYLSRNNKGIKHHydrophilic
NLS Segment(s)
PositionSequence
17-32KKVNFTKNRKRNSKRP
Subcellular Location(s) mito 20.5, cyto_mito 12.833, cyto 4, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027073  5_3_exoribonuclease  
IPR041412  Xrn1_helical  
Gene Ontology GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF17846  XRN_M  
Amino Acid Sequences MAIYIAWSFGVRSLNRKKVNFTKNRKRNSKRPYLSRNNKGIKHVWNSYYDVFTSWSWVYPYFHSPMISDSNSSPSISNLINCVRLNFSFNLSNPFKLFDKTMGVLPELISAHISPKFYLSQIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.53
4 0.59
5 0.63
6 0.73
7 0.74
8 0.76
9 0.78
10 0.79
11 0.87
12 0.9
13 0.89
14 0.88
15 0.87
16 0.88
17 0.86
18 0.87
19 0.87
20 0.87
21 0.89
22 0.87
23 0.87
24 0.84
25 0.77
26 0.72
27 0.66
28 0.62
29 0.57
30 0.52
31 0.45
32 0.4
33 0.4
34 0.37
35 0.32
36 0.25
37 0.2
38 0.18
39 0.15
40 0.16
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.13
47 0.15
48 0.14
49 0.15
50 0.14
51 0.14
52 0.15
53 0.17
54 0.16
55 0.15
56 0.13
57 0.16
58 0.16
59 0.17
60 0.14
61 0.11
62 0.13
63 0.12
64 0.12
65 0.12
66 0.12
67 0.16
68 0.16
69 0.17
70 0.17
71 0.17
72 0.2
73 0.18
74 0.2
75 0.19
76 0.2
77 0.27
78 0.26
79 0.27
80 0.25
81 0.27
82 0.25
83 0.23
84 0.24
85 0.19
86 0.22
87 0.21
88 0.24
89 0.22
90 0.21
91 0.2
92 0.19
93 0.19
94 0.15
95 0.14
96 0.12
97 0.11
98 0.14
99 0.16
100 0.17
101 0.14
102 0.17
103 0.18