Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UYG6

Protein Details
Accession A0A0L6UYG6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
48-68ASRNLKKKMSRYTVNKNLPFHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, mito 7, nucl 5, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences SFIFIVPCLSWKALFSPGNLDKIVEAICKAGPQDQDYTLLLDSIKSSASRNLKKKMSRYTVNKNLPFHGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.28
4 0.3
5 0.32
6 0.31
7 0.29
8 0.21
9 0.21
10 0.21
11 0.12
12 0.1
13 0.08
14 0.08
15 0.08
16 0.08
17 0.11
18 0.11
19 0.12
20 0.14
21 0.14
22 0.16
23 0.15
24 0.16
25 0.13
26 0.12
27 0.1
28 0.08
29 0.08
30 0.06
31 0.07
32 0.06
33 0.07
34 0.14
35 0.23
36 0.32
37 0.39
38 0.46
39 0.54
40 0.6
41 0.67
42 0.71
43 0.71
44 0.72
45 0.74
46 0.77
47 0.8
48 0.83
49 0.81
50 0.74