Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UIB2

Protein Details
Accession A0A0L6UIB2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MPKKASPKPTKPTTKKPAIQRKSKKNRGNNSSEDHydrophilic
NLS Segment(s)
PositionSequence
3-27KKASPKPTKPTTKKPAIQRKSKKNR
Subcellular Location(s) mito 20, mito_nucl 13.333, nucl 4.5, cyto_nucl 4.166
Family & Domain DBs
Amino Acid Sequences MPKKASPKPTKPTTKKPAIQRKSKKNRGNNSSEDAAADKTAGHLKKEDYLVIIEWLKIEWNYNSCFGTGKAPAVGRPAKGKINGFEMMAINLCNQSPSKIMLNFYLMAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.85
4 0.86
5 0.84
6 0.86
7 0.86
8 0.87
9 0.88
10 0.91
11 0.9
12 0.89
13 0.9
14 0.88
15 0.85
16 0.79
17 0.73
18 0.65
19 0.55
20 0.46
21 0.36
22 0.28
23 0.2
24 0.15
25 0.09
26 0.08
27 0.13
28 0.13
29 0.13
30 0.14
31 0.15
32 0.18
33 0.19
34 0.18
35 0.14
36 0.14
37 0.13
38 0.13
39 0.13
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.07
47 0.09
48 0.1
49 0.12
50 0.12
51 0.12
52 0.13
53 0.12
54 0.15
55 0.13
56 0.13
57 0.13
58 0.13
59 0.14
60 0.19
61 0.21
62 0.19
63 0.22
64 0.25
65 0.27
66 0.31
67 0.32
68 0.29
69 0.32
70 0.32
71 0.27
72 0.26
73 0.23
74 0.19
75 0.17
76 0.15
77 0.11
78 0.11
79 0.1
80 0.1
81 0.1
82 0.11
83 0.12
84 0.15
85 0.2
86 0.22
87 0.24
88 0.25
89 0.28