Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VIN2

Protein Details
Accession A0A0L6VIN2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKKASPKPTKPAIQRKSKKNRTGHLKKEDYBasic
NLS Segment(s)
PositionSequence
3-27KKASPKPTKPAIQRKSKKNRTGHLK
Subcellular Location(s) mito 16, mito_nucl 13.833, nucl 9.5, cyto_nucl 5.666
Family & Domain DBs
Amino Acid Sequences MPKKASPKPTKPAIQRKSKKNRTGHLKKEDYLVIIEWLTIEPNYNSCFGTGKAPSGGSPAKGKINGFEMMAINLRNQSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.85
4 0.88
5 0.89
6 0.88
7 0.85
8 0.85
9 0.85
10 0.86
11 0.86
12 0.84
13 0.79
14 0.71
15 0.66
16 0.57
17 0.47
18 0.37
19 0.27
20 0.18
21 0.13
22 0.12
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.08
31 0.08
32 0.08
33 0.08
34 0.1
35 0.1
36 0.14
37 0.14
38 0.14
39 0.14
40 0.15
41 0.14
42 0.18
43 0.18
44 0.16
45 0.19
46 0.2
47 0.23
48 0.25
49 0.25
50 0.23
51 0.26
52 0.25
53 0.22
54 0.22
55 0.18
56 0.18
57 0.2
58 0.18
59 0.15