Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6U8T8

Protein Details
Accession A0A0L6U8T8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-77RSSIRKDKSIRRNKQGGKEKNFBasic
NLS Segment(s)
PositionSequence
56-73RSSIRKDKSIRRNKQGGK
Subcellular Location(s) mito 19.5, cyto_mito 12.333, cyto_nucl 4.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001969  Aspartic_peptidase_AS  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
PROSITE View protein in PROSITE  
PS00141  ASP_PROTEASE  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MARRRLTSPRSKHSSQESIGTMPPLLSISKKGFRKANSTPSIFKNKDNLNPPRLLRSSIRKDKSIRRNKQGGKEKNFVCIVVGNMSLTLVSNKFLKTTNYPLFRESCFEPVRSLMMSLVLRFILFDSLNQPYRVLLDSGANVSFISLEFAKRKSLPLTDINSFQVYLVNSLEESSFWVLKKTKWTFHFSNFTSVELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.62
3 0.59
4 0.51
5 0.46
6 0.44
7 0.39
8 0.3
9 0.21
10 0.19
11 0.14
12 0.12
13 0.11
14 0.15
15 0.19
16 0.27
17 0.31
18 0.36
19 0.41
20 0.44
21 0.51
22 0.54
23 0.58
24 0.58
25 0.59
26 0.58
27 0.58
28 0.65
29 0.58
30 0.54
31 0.51
32 0.49
33 0.52
34 0.56
35 0.57
36 0.52
37 0.56
38 0.54
39 0.54
40 0.49
41 0.46
42 0.42
43 0.45
44 0.5
45 0.54
46 0.57
47 0.54
48 0.59
49 0.65
50 0.71
51 0.72
52 0.71
53 0.7
54 0.76
55 0.77
56 0.82
57 0.82
58 0.81
59 0.77
60 0.76
61 0.68
62 0.64
63 0.57
64 0.47
65 0.37
66 0.28
67 0.21
68 0.14
69 0.14
70 0.08
71 0.07
72 0.07
73 0.06
74 0.05
75 0.06
76 0.04
77 0.05
78 0.07
79 0.07
80 0.08
81 0.09
82 0.11
83 0.14
84 0.21
85 0.27
86 0.31
87 0.31
88 0.32
89 0.33
90 0.32
91 0.31
92 0.25
93 0.25
94 0.21
95 0.21
96 0.2
97 0.18
98 0.19
99 0.16
100 0.15
101 0.09
102 0.11
103 0.1
104 0.1
105 0.1
106 0.08
107 0.08
108 0.08
109 0.08
110 0.06
111 0.06
112 0.07
113 0.09
114 0.13
115 0.16
116 0.16
117 0.16
118 0.14
119 0.15
120 0.16
121 0.14
122 0.1
123 0.1
124 0.1
125 0.11
126 0.11
127 0.1
128 0.09
129 0.08
130 0.08
131 0.06
132 0.08
133 0.07
134 0.09
135 0.12
136 0.13
137 0.17
138 0.18
139 0.21
140 0.22
141 0.24
142 0.26
143 0.31
144 0.36
145 0.35
146 0.36
147 0.36
148 0.33
149 0.31
150 0.26
151 0.22
152 0.17
153 0.16
154 0.14
155 0.12
156 0.11
157 0.11
158 0.11
159 0.08
160 0.11
161 0.12
162 0.14
163 0.14
164 0.19
165 0.21
166 0.24
167 0.34
168 0.38
169 0.43
170 0.46
171 0.54
172 0.55
173 0.61
174 0.68
175 0.6
176 0.62
177 0.55