Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UDB9

Protein Details
Accession A0A0L6UDB9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
113-133ASSPRRLKKLLKKLDRMSIKKHydrophilic
NLS Segment(s)
PositionSequence
117-128RRLKKLLKKLDR
Subcellular Location(s) nucl 12, cyto_nucl 10.333, mito_nucl 8.833, cyto 7.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046798  2OG-FeII_Oxy_6  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20515  2OG-FeII_Oxy_6  
Amino Acid Sequences MLGTSEKVTKDPDRYCKLQSHVPEQNTFIGKWFYLVSGPLFDEVKKQHKALKAPGAKTMMPKPSHFPCGSQLNRPPDSTALWSVPGKSLHILTQLLLPIHLLNPYILVWGYLASSPRRLKKLLKKLDRMSIKKILIKATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.59
4 0.58
5 0.56
6 0.54
7 0.54
8 0.55
9 0.55
10 0.53
11 0.48
12 0.49
13 0.44
14 0.38
15 0.31
16 0.24
17 0.2
18 0.19
19 0.17
20 0.12
21 0.11
22 0.12
23 0.1
24 0.1
25 0.11
26 0.11
27 0.11
28 0.11
29 0.14
30 0.17
31 0.23
32 0.25
33 0.25
34 0.29
35 0.34
36 0.38
37 0.41
38 0.46
39 0.46
40 0.44
41 0.48
42 0.46
43 0.42
44 0.41
45 0.39
46 0.36
47 0.32
48 0.31
49 0.32
50 0.32
51 0.36
52 0.33
53 0.29
54 0.27
55 0.34
56 0.35
57 0.35
58 0.38
59 0.39
60 0.41
61 0.4
62 0.36
63 0.28
64 0.28
65 0.25
66 0.21
67 0.15
68 0.15
69 0.15
70 0.15
71 0.17
72 0.16
73 0.14
74 0.13
75 0.13
76 0.12
77 0.14
78 0.14
79 0.11
80 0.12
81 0.13
82 0.12
83 0.11
84 0.11
85 0.09
86 0.09
87 0.09
88 0.07
89 0.06
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.1
100 0.11
101 0.18
102 0.25
103 0.31
104 0.35
105 0.38
106 0.46
107 0.55
108 0.64
109 0.68
110 0.72
111 0.75
112 0.78
113 0.84
114 0.85
115 0.79
116 0.75
117 0.73
118 0.69
119 0.64
120 0.61