Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VK42

Protein Details
Accession A0A0L6VK42   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKSAKSYKRPSRKEKMGLSASHydrophilic
62-84QPNHSLPLPSKKPRKKFVDRRSKBasic
NLS Segment(s)
PositionSequence
71-84SKKPRKKFVDRRSK
Subcellular Location(s) mito 15.5, mito_nucl 13.833, nucl 11, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MGKSAKSYKRPSRKEKMGLSASTSCLRAAIPTGKLNKPQPNTLLPTHQPPPPPKPDSTSLPQPNHSLPLPSKKPRKKFVDRRSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.82
4 0.78
5 0.69
6 0.65
7 0.56
8 0.49
9 0.42
10 0.35
11 0.26
12 0.2
13 0.18
14 0.13
15 0.13
16 0.14
17 0.15
18 0.19
19 0.24
20 0.26
21 0.31
22 0.37
23 0.41
24 0.4
25 0.4
26 0.38
27 0.37
28 0.39
29 0.35
30 0.34
31 0.28
32 0.3
33 0.29
34 0.29
35 0.3
36 0.31
37 0.36
38 0.4
39 0.42
40 0.39
41 0.41
42 0.44
43 0.44
44 0.45
45 0.49
46 0.5
47 0.49
48 0.5
49 0.49
50 0.45
51 0.43
52 0.38
53 0.33
54 0.29
55 0.36
56 0.42
57 0.48
58 0.58
59 0.64
60 0.73
61 0.77
62 0.83
63 0.85
64 0.87