Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UCP0

Protein Details
Accession A0A0L6UCP0   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-34PMEPTTKKPAIQRKSKKNRGNDSSEDHydrophilic
NLS Segment(s)
PositionSequence
20-25QRKSKK
Subcellular Location(s) nucl 12, mito_nucl 10.333, cyto_nucl 8.333, mito 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPKKATSNPMEPTTKKPAIQRKSKKNRGNDSSEDDDADKTAGHLKKEDYLVIIEWLKIKWNYNSCFGTGKAPSVGCPDKVQINCFEMMAINIQIQSPRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.53
4 0.57
5 0.59
6 0.67
7 0.71
8 0.73
9 0.81
10 0.88
11 0.87
12 0.87
13 0.88
14 0.84
15 0.81
16 0.75
17 0.71
18 0.66
19 0.59
20 0.5
21 0.4
22 0.32
23 0.25
24 0.2
25 0.12
26 0.07
27 0.14
28 0.15
29 0.15
30 0.16
31 0.16
32 0.2
33 0.21
34 0.2
35 0.14
36 0.13
37 0.12
38 0.13
39 0.12
40 0.09
41 0.09
42 0.09
43 0.11
44 0.11
45 0.13
46 0.17
47 0.23
48 0.25
49 0.3
50 0.32
51 0.3
52 0.31
53 0.3
54 0.3
55 0.23
56 0.23
57 0.2
58 0.19
59 0.18
60 0.23
61 0.24
62 0.21
63 0.22
64 0.23
65 0.27
66 0.29
67 0.3
68 0.27
69 0.28
70 0.27
71 0.25
72 0.23
73 0.16
74 0.15
75 0.15
76 0.12
77 0.1
78 0.1
79 0.11
80 0.13