Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UJ40

Protein Details
Accession A0A0L6UJ40    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
156-181LTGARNNKPTCNRNKSRRSNMITDLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, vacu 2
Family & Domain DBs
Amino Acid Sequences TVDSPMVDSGGSWRRGRRTSSRDCTRCSDERDTAARTSGHKAMVSGRGTTEVFMLRLDSDLTSRLLQHKASVDELYSTYGFLPAFRYRYDLLVTGDTFSSRFDSPPNARIHSLPDIWQFRKDLWNRSYNLSQQLDELGFDDNLYRKGGVRSSWDPLTGARNNKPTCNRNKSRRSNMITDLHPDPNLHPARTKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.5
4 0.54
5 0.57
6 0.63
7 0.71
8 0.77
9 0.75
10 0.75
11 0.75
12 0.72
13 0.69
14 0.65
15 0.62
16 0.55
17 0.55
18 0.55
19 0.51
20 0.45
21 0.41
22 0.36
23 0.31
24 0.32
25 0.29
26 0.27
27 0.24
28 0.24
29 0.25
30 0.3
31 0.28
32 0.24
33 0.21
34 0.22
35 0.22
36 0.21
37 0.19
38 0.13
39 0.11
40 0.11
41 0.11
42 0.08
43 0.09
44 0.09
45 0.08
46 0.07
47 0.08
48 0.1
49 0.1
50 0.11
51 0.14
52 0.15
53 0.15
54 0.17
55 0.19
56 0.19
57 0.2
58 0.19
59 0.16
60 0.15
61 0.15
62 0.15
63 0.12
64 0.1
65 0.08
66 0.09
67 0.09
68 0.08
69 0.11
70 0.12
71 0.13
72 0.13
73 0.16
74 0.15
75 0.17
76 0.18
77 0.15
78 0.14
79 0.15
80 0.15
81 0.12
82 0.12
83 0.1
84 0.09
85 0.08
86 0.09
87 0.08
88 0.08
89 0.08
90 0.14
91 0.17
92 0.24
93 0.26
94 0.26
95 0.27
96 0.27
97 0.3
98 0.27
99 0.26
100 0.21
101 0.24
102 0.28
103 0.28
104 0.3
105 0.26
106 0.24
107 0.32
108 0.33
109 0.35
110 0.34
111 0.4
112 0.39
113 0.44
114 0.46
115 0.41
116 0.45
117 0.38
118 0.34
119 0.28
120 0.28
121 0.23
122 0.19
123 0.17
124 0.11
125 0.09
126 0.08
127 0.1
128 0.09
129 0.1
130 0.11
131 0.11
132 0.11
133 0.14
134 0.16
135 0.17
136 0.23
137 0.25
138 0.29
139 0.3
140 0.29
141 0.28
142 0.27
143 0.32
144 0.3
145 0.33
146 0.34
147 0.42
148 0.43
149 0.5
150 0.58
151 0.59
152 0.65
153 0.69
154 0.73
155 0.75
156 0.84
157 0.87
158 0.89
159 0.9
160 0.86
161 0.82
162 0.8
163 0.76
164 0.68
165 0.63
166 0.57
167 0.49
168 0.44
169 0.38
170 0.31
171 0.34
172 0.36
173 0.33
174 0.34