Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UE51

Protein Details
Accession A0A0L6UE51    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-35LTGPLPPASRPKRPKQTKQYRELVAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MVNTRRSNSVLTGPLPPASRPKRPKQTKQYRELVALPPLPPSPEPTTPLEIIPQLGNPWRVPEGVTGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.27
4 0.31
5 0.33
6 0.41
7 0.45
8 0.54
9 0.62
10 0.71
11 0.8
12 0.82
13 0.87
14 0.87
15 0.87
16 0.85
17 0.76
18 0.69
19 0.61
20 0.52
21 0.44
22 0.36
23 0.28
24 0.22
25 0.19
26 0.18
27 0.15
28 0.18
29 0.19
30 0.2
31 0.23
32 0.25
33 0.29
34 0.29
35 0.29
36 0.25
37 0.21
38 0.2
39 0.17
40 0.14
41 0.13
42 0.16
43 0.18
44 0.17
45 0.2
46 0.2
47 0.2
48 0.2