Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6U8Z0

Protein Details
Accession A0A0L6U8Z0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTKTKNEKKLRYPRNVSWKVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_nucl 2.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR002908  Frataxin/CyaY  
IPR036524  Frataxin/CyaY_sf  
IPR020895  Frataxin_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0008199  F:ferric iron binding  
GO:0034755  P:iron ion transmembrane transport  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF01491  Frataxin_Cyay  
PROSITE View protein in PROSITE  
PS01344  FRATAXIN_1  
PS50810  FRATAXIN_2  
Amino Acid Sequences MTKTKNEKKLRYPRNVSWKVIMPKYPAGMWTIRGVMNFSLGTRGTYVINKQPPNKQIWLSSPFSSAKNPILFLYFFFLDSGPKRFDYDKEQKCWFYGREGKELMSLLGAEVDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.77
4 0.71
5 0.69
6 0.65
7 0.61
8 0.55
9 0.48
10 0.45
11 0.43
12 0.38
13 0.3
14 0.26
15 0.23
16 0.2
17 0.18
18 0.17
19 0.16
20 0.15
21 0.16
22 0.13
23 0.14
24 0.13
25 0.1
26 0.11
27 0.1
28 0.1
29 0.09
30 0.1
31 0.09
32 0.11
33 0.13
34 0.17
35 0.24
36 0.27
37 0.3
38 0.35
39 0.37
40 0.4
41 0.41
42 0.36
43 0.32
44 0.33
45 0.35
46 0.32
47 0.29
48 0.27
49 0.26
50 0.26
51 0.25
52 0.22
53 0.21
54 0.19
55 0.19
56 0.16
57 0.17
58 0.16
59 0.15
60 0.17
61 0.13
62 0.12
63 0.12
64 0.11
65 0.12
66 0.14
67 0.17
68 0.16
69 0.16
70 0.18
71 0.2
72 0.23
73 0.3
74 0.38
75 0.43
76 0.47
77 0.51
78 0.5
79 0.5
80 0.52
81 0.44
82 0.42
83 0.43
84 0.42
85 0.43
86 0.43
87 0.42
88 0.4
89 0.39
90 0.3
91 0.22
92 0.18
93 0.11
94 0.11