Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V7E2

Protein Details
Accession A0A0L6V7E2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-32HSSYPSYPGKRLKTKKQQKKEENEDKNTVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.333, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences MRAHSSYPSYPGKRLKTKKQQKKEENEDKNTVDDGDGNNHILDLQRNHTSQTANQAYGRTSGVYDFGKLMDNGTNIYLVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.73
3 0.75
4 0.83
5 0.87
6 0.89
7 0.91
8 0.91
9 0.92
10 0.92
11 0.92
12 0.9
13 0.85
14 0.79
15 0.69
16 0.6
17 0.5
18 0.39
19 0.28
20 0.2
21 0.14
22 0.12
23 0.12
24 0.11
25 0.1
26 0.1
27 0.1
28 0.09
29 0.1
30 0.08
31 0.11
32 0.14
33 0.15
34 0.16
35 0.18
36 0.19
37 0.18
38 0.26
39 0.26
40 0.24
41 0.25
42 0.25
43 0.24
44 0.24
45 0.24
46 0.15
47 0.12
48 0.11
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.15
60 0.15