Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UDI6

Protein Details
Accession A0A0L6UDI6   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-161LVSIGRRKPSDLPRRKKRPGSDFPEDIHydrophilic
NLS Segment(s)
PositionSequence
140-153RRKPSDLPRRKKRP
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPQSPSGHSSSSSVLSDSTQPSSTRSCSNVGRASPVSELAELSYKEIKALKQYSHSVQNFTYQLFENFRLEQEAKGRPSPPVQITDPSHLSQRKNYESRKEEPDHDLPGFRSTELLNDNNGCSPRFDNLLFPQPLVSIGRRKPSDLPRRKKRPGSDFPEDIGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.2
4 0.2
5 0.21
6 0.2
7 0.2
8 0.22
9 0.26
10 0.27
11 0.27
12 0.27
13 0.28
14 0.29
15 0.36
16 0.39
17 0.35
18 0.38
19 0.35
20 0.35
21 0.31
22 0.3
23 0.24
24 0.18
25 0.18
26 0.13
27 0.15
28 0.13
29 0.15
30 0.16
31 0.14
32 0.16
33 0.18
34 0.17
35 0.22
36 0.25
37 0.24
38 0.27
39 0.3
40 0.33
41 0.4
42 0.4
43 0.35
44 0.32
45 0.35
46 0.31
47 0.28
48 0.26
49 0.17
50 0.18
51 0.18
52 0.19
53 0.16
54 0.16
55 0.16
56 0.17
57 0.17
58 0.16
59 0.18
60 0.21
61 0.21
62 0.23
63 0.23
64 0.21
65 0.23
66 0.26
67 0.23
68 0.22
69 0.21
70 0.24
71 0.25
72 0.28
73 0.28
74 0.25
75 0.28
76 0.28
77 0.28
78 0.27
79 0.32
80 0.35
81 0.4
82 0.43
83 0.48
84 0.5
85 0.53
86 0.57
87 0.54
88 0.5
89 0.49
90 0.48
91 0.43
92 0.38
93 0.35
94 0.28
95 0.28
96 0.25
97 0.18
98 0.16
99 0.12
100 0.14
101 0.17
102 0.17
103 0.16
104 0.17
105 0.17
106 0.19
107 0.21
108 0.18
109 0.16
110 0.17
111 0.16
112 0.19
113 0.19
114 0.2
115 0.24
116 0.32
117 0.31
118 0.3
119 0.28
120 0.25
121 0.26
122 0.24
123 0.23
124 0.22
125 0.26
126 0.35
127 0.36
128 0.39
129 0.45
130 0.53
131 0.61
132 0.64
133 0.71
134 0.73
135 0.82
136 0.89
137 0.9
138 0.9
139 0.89
140 0.89
141 0.87
142 0.85
143 0.78