Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6CX20

Protein Details
Accession Q6CX20    Localization Confidence High Confidence Score 21.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-56AKKTAGRRSEKLKKRRWRQCKVEEEEEEBasic
67-88DKTIAFGKRRNRKENRNSHLFFHydrophilic
98-118STLITGKKNVHRKRCKVPTEDHydrophilic
NLS Segment(s)
PositionSequence
29-45AKKTAGRRSEKLKKRRW
75-77RRN
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
KEGG kla:KLLA0_A11913g  -  
Amino Acid Sequences MVFPICNENLFTEVCKSVNEDPSDVLRLAKKTAGRRSEKLKKRRWRQCKVEEEEEEDPDVVPPTPKDKTIAFGKRRNRKENRNSHLFFKKYQILTSHSTLITGKKNVHRKRCKVPTEDENDVPVLSTIKRDSLLRVSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.19
4 0.23
5 0.29
6 0.29
7 0.27
8 0.28
9 0.3
10 0.32
11 0.28
12 0.24
13 0.21
14 0.21
15 0.21
16 0.23
17 0.25
18 0.31
19 0.39
20 0.46
21 0.49
22 0.53
23 0.61
24 0.68
25 0.73
26 0.75
27 0.76
28 0.78
29 0.82
30 0.88
31 0.89
32 0.89
33 0.89
34 0.89
35 0.9
36 0.86
37 0.84
38 0.74
39 0.7
40 0.61
41 0.51
42 0.42
43 0.31
44 0.24
45 0.16
46 0.15
47 0.09
48 0.07
49 0.07
50 0.1
51 0.11
52 0.11
53 0.13
54 0.13
55 0.17
56 0.25
57 0.33
58 0.36
59 0.43
60 0.51
61 0.59
62 0.66
63 0.72
64 0.72
65 0.74
66 0.78
67 0.82
68 0.8
69 0.8
70 0.74
71 0.72
72 0.72
73 0.63
74 0.54
75 0.48
76 0.48
77 0.39
78 0.39
79 0.35
80 0.31
81 0.34
82 0.35
83 0.33
84 0.25
85 0.25
86 0.24
87 0.25
88 0.25
89 0.24
90 0.27
91 0.32
92 0.42
93 0.5
94 0.6
95 0.67
96 0.7
97 0.78
98 0.83
99 0.83
100 0.79
101 0.79
102 0.78
103 0.75
104 0.73
105 0.64
106 0.55
107 0.48
108 0.41
109 0.33
110 0.24
111 0.18
112 0.12
113 0.14
114 0.13
115 0.15
116 0.17
117 0.17
118 0.22