Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VST2

Protein Details
Accession A0A0L6VST2    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LPPLWQTKLKKQIRHLQMRDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences FALPPLWQTKLKKQIRHLQMRDDETFMGYSTHARTIQHMLNFVRVSVDDFELAEYLTCGFEFESRVSGFYTGLHKFQSTKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.81
4 0.74
5 0.73
6 0.73
7 0.71
8 0.64
9 0.55
10 0.45
11 0.35
12 0.32
13 0.23
14 0.16
15 0.1
16 0.1
17 0.1
18 0.12
19 0.12
20 0.12
21 0.14
22 0.17
23 0.2
24 0.2
25 0.22
26 0.2
27 0.22
28 0.22
29 0.2
30 0.16
31 0.13
32 0.14
33 0.11
34 0.12
35 0.08
36 0.08
37 0.08
38 0.08
39 0.08
40 0.06
41 0.05
42 0.05
43 0.05
44 0.04
45 0.05
46 0.05
47 0.06
48 0.08
49 0.09
50 0.12
51 0.12
52 0.13
53 0.14
54 0.14
55 0.13
56 0.14
57 0.19
58 0.18
59 0.19
60 0.2
61 0.2
62 0.22