Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VRZ6

Protein Details
Accession A0A0L6VRZ6   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-102RDPYHFNHIRNRRRSQKNPSKFNQSEKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, golg 2
Family & Domain DBs
Amino Acid Sequences MENAQDVENSASLSKKRFYEYQTMNPTQRGIQLNIITQIIEGSGIFVNIPLPGQAQKTKGRPKGTSNKPKSTTTRDPYHFNHIRNRRRSQKNPSKFNQSEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.26
4 0.3
5 0.34
6 0.41
7 0.45
8 0.52
9 0.57
10 0.59
11 0.57
12 0.53
13 0.5
14 0.41
15 0.4
16 0.33
17 0.26
18 0.26
19 0.25
20 0.25
21 0.26
22 0.25
23 0.18
24 0.15
25 0.13
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.03
38 0.04
39 0.05
40 0.08
41 0.1
42 0.14
43 0.19
44 0.27
45 0.35
46 0.41
47 0.46
48 0.47
49 0.54
50 0.6
51 0.66
52 0.7
53 0.69
54 0.72
55 0.71
56 0.74
57 0.71
58 0.7
59 0.69
60 0.65
61 0.66
62 0.6
63 0.63
64 0.6
65 0.64
66 0.61
67 0.55
68 0.59
69 0.6
70 0.66
71 0.69
72 0.75
73 0.75
74 0.79
75 0.85
76 0.86
77 0.87
78 0.88
79 0.89
80 0.87
81 0.87
82 0.81