Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6V1I8

Protein Details
Accession A0A0L6V1I8    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-54ATAAASKNSRPYRKKKKKEQKKDNKRDKKGKEDIITBasic
97-121PCPFYECKQKKILKKIRKKKKKNSRBasic
NLS Segment(s)
PositionSequence
26-49NSRPYRKKKKKEQKKDNKRDKKGK
106-121KKILKKIRKKKKKNSR
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029466  NAM-associated_C  
Pfam View protein in Pfam  
PF14303  NAM-associated  
Amino Acid Sequences MTHDSVEEKQVDAVSNVTATAAASKNSRPYRKKKKKEQKKDNKRDKKGKEDIITVLRNLANQTALQNQILADQKDVMVTMANKKIMSIDILTISASPCPFYECKQKKILKKIRKKKKKNSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.07
6 0.06
7 0.09
8 0.09
9 0.1
10 0.12
11 0.14
12 0.23
13 0.32
14 0.41
15 0.46
16 0.56
17 0.66
18 0.75
19 0.84
20 0.87
21 0.9
22 0.92
23 0.96
24 0.96
25 0.96
26 0.96
27 0.97
28 0.97
29 0.96
30 0.95
31 0.94
32 0.9
33 0.89
34 0.85
35 0.82
36 0.74
37 0.66
38 0.59
39 0.54
40 0.48
41 0.37
42 0.31
43 0.23
44 0.2
45 0.18
46 0.14
47 0.09
48 0.08
49 0.09
50 0.09
51 0.1
52 0.09
53 0.09
54 0.09
55 0.12
56 0.15
57 0.14
58 0.12
59 0.12
60 0.12
61 0.11
62 0.11
63 0.08
64 0.07
65 0.07
66 0.12
67 0.14
68 0.16
69 0.16
70 0.16
71 0.16
72 0.15
73 0.16
74 0.12
75 0.1
76 0.1
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.09
83 0.09
84 0.08
85 0.12
86 0.14
87 0.17
88 0.28
89 0.33
90 0.39
91 0.48
92 0.56
93 0.6
94 0.7
95 0.77
96 0.77
97 0.82
98 0.87
99 0.89
100 0.93
101 0.95