Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VN45

Protein Details
Accession A0A0L6VN45    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-38SSFGKRHSKTHTQCRRCGRRSFHKQHKSQSSSPHydrophilic
NLS Segment(s)
PositionSequence
77-93KAKRRHTTGTGRMRHLK
Subcellular Location(s) cyto_nucl 10.333, nucl 10, cyto 9.5, mito_nucl 9.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTSSFGKRHSKTHTQCRRCGRRSFHKQHKSQSSSPIAHTWRVAYRYIHTRLNFLACAACGYPAAKTRSYEWGAKAKRRHTTGTGRMRHLKDVPRRFKNGFREGTVATRKTASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.76
4 0.73
5 0.79
6 0.83
7 0.85
8 0.82
9 0.82
10 0.8
11 0.8
12 0.84
13 0.86
14 0.87
15 0.86
16 0.86
17 0.86
18 0.87
19 0.83
20 0.76
21 0.73
22 0.7
23 0.62
24 0.57
25 0.53
26 0.44
27 0.38
28 0.35
29 0.29
30 0.25
31 0.24
32 0.25
33 0.2
34 0.21
35 0.27
36 0.3
37 0.33
38 0.3
39 0.3
40 0.28
41 0.29
42 0.25
43 0.18
44 0.15
45 0.09
46 0.1
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.12
53 0.15
54 0.15
55 0.17
56 0.19
57 0.25
58 0.28
59 0.3
60 0.28
61 0.35
62 0.38
63 0.44
64 0.49
65 0.49
66 0.53
67 0.54
68 0.55
69 0.52
70 0.57
71 0.6
72 0.64
73 0.64
74 0.63
75 0.67
76 0.65
77 0.63
78 0.59
79 0.58
80 0.59
81 0.63
82 0.67
83 0.67
84 0.71
85 0.7
86 0.73
87 0.74
88 0.73
89 0.67
90 0.61
91 0.57
92 0.53
93 0.57
94 0.56
95 0.48
96 0.4