Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6VIA3

Protein Details
Accession A0A0L6VIA3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-83KIPWARKNRFQPLKSKKKKKNPDQPMKPLHYSDHydrophilic
NLS Segment(s)
PositionSequence
55-71ARKNRFQPLKSKKKKKN
Subcellular Location(s) nucl 16, mito_nucl 13.666, cyto_nucl 10.166, mito 9
Family & Domain DBs
Amino Acid Sequences IQSLSHMSYQMCYSLYNIKTSPLTCQYKETDSSLVCRNELFLGNHFFSLNKIPWARKNRFQPLKSKKKKKNPDQPMKPLHYSDFSKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.22
5 0.23
6 0.25
7 0.25
8 0.29
9 0.3
10 0.34
11 0.31
12 0.35
13 0.36
14 0.36
15 0.38
16 0.34
17 0.29
18 0.24
19 0.26
20 0.28
21 0.26
22 0.23
23 0.2
24 0.19
25 0.17
26 0.19
27 0.17
28 0.13
29 0.16
30 0.16
31 0.16
32 0.16
33 0.14
34 0.13
35 0.15
36 0.13
37 0.14
38 0.16
39 0.18
40 0.26
41 0.35
42 0.4
43 0.44
44 0.53
45 0.6
46 0.67
47 0.68
48 0.71
49 0.73
50 0.79
51 0.82
52 0.84
53 0.84
54 0.85
55 0.93
56 0.93
57 0.93
58 0.93
59 0.94
60 0.93
61 0.93
62 0.92
63 0.88
64 0.81
65 0.73
66 0.65
67 0.61
68 0.54