Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6V0V0

Protein Details
Accession A0A0L6V0V0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-48HINTAPSFKRKKKKDLNEKRHHLNRHBasic
NLS Segment(s)
PositionSequence
31-42KRKKKKDLNEKR
Subcellular Location(s) nucl 19, cyto_nucl 15.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences MVQVLISAPVLKPEDLEHLQKPHINTAPSFKRKKKKDLNEKRHHLNRHLSGVQVIIENCIAILKDRFQGLKGLRLQLLRKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.27
4 0.27
5 0.28
6 0.3
7 0.32
8 0.32
9 0.31
10 0.32
11 0.29
12 0.27
13 0.32
14 0.4
15 0.46
16 0.53
17 0.54
18 0.6
19 0.65
20 0.75
21 0.77
22 0.78
23 0.81
24 0.84
25 0.87
26 0.88
27 0.88
28 0.86
29 0.83
30 0.76
31 0.7
32 0.66
33 0.59
34 0.55
35 0.49
36 0.4
37 0.33
38 0.3
39 0.25
40 0.19
41 0.15
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.08
50 0.09
51 0.12
52 0.14
53 0.15
54 0.16
55 0.23
56 0.23
57 0.3
58 0.32
59 0.34
60 0.35
61 0.39
62 0.45