Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L6UWS6

Protein Details
Accession A0A0L6UWS6   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-31LTNQKIKHLQYKAKCWKQKRLKANVSISVHydrophilic
96-118QSTYQCITAKKKKKNLLNCLQLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 13.166, cyto_nucl 11.166, mito 7
Family & Domain DBs
Amino Acid Sequences MPLTNQKIKHLQYKAKCWKQKRLKANVSISVVENLPVNISNPNPKSIILLFDKSFICWADESWKNIVAVVKFHPFSTMDTSLKSQYQLLSQHLMAQSTYQCITAKKKKKNLLNCLQLTGRESNGAHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.78
3 0.82
4 0.81
5 0.83
6 0.85
7 0.86
8 0.85
9 0.85
10 0.84
11 0.84
12 0.84
13 0.8
14 0.72
15 0.64
16 0.55
17 0.46
18 0.36
19 0.27
20 0.21
21 0.13
22 0.1
23 0.09
24 0.08
25 0.08
26 0.1
27 0.17
28 0.18
29 0.2
30 0.2
31 0.2
32 0.21
33 0.2
34 0.23
35 0.18
36 0.2
37 0.18
38 0.21
39 0.21
40 0.18
41 0.19
42 0.15
43 0.13
44 0.1
45 0.1
46 0.13
47 0.15
48 0.17
49 0.18
50 0.19
51 0.17
52 0.18
53 0.2
54 0.14
55 0.13
56 0.14
57 0.16
58 0.15
59 0.15
60 0.15
61 0.14
62 0.16
63 0.2
64 0.22
65 0.19
66 0.2
67 0.22
68 0.23
69 0.23
70 0.21
71 0.16
72 0.13
73 0.17
74 0.18
75 0.19
76 0.2
77 0.19
78 0.22
79 0.22
80 0.22
81 0.18
82 0.17
83 0.15
84 0.15
85 0.15
86 0.12
87 0.13
88 0.16
89 0.26
90 0.34
91 0.44
92 0.51
93 0.6
94 0.67
95 0.76
96 0.83
97 0.84
98 0.84
99 0.85
100 0.77
101 0.73
102 0.66
103 0.59
104 0.52
105 0.44
106 0.35
107 0.29