Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UBR5

Protein Details
Accession A0A0L6UBR5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHKNGIHRPKRCRYPSHydrophilic
NLS Segment(s)
PositionSequence
14-52KKAHKNGIHRPKRCRYPSLKGVDPKFRRNQKFAKHGTQK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIHRPKRCRYPSLKGVDPKFRRNQKFAKHGTQKALAAARAEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.8
4 0.78
5 0.76
6 0.78
7 0.82
8 0.81
9 0.79
10 0.79
11 0.8
12 0.81
13 0.76
14 0.74
15 0.7
16 0.69
17 0.71
18 0.68
19 0.65
20 0.61
21 0.61
22 0.63
23 0.6
24 0.59
25 0.6
26 0.63
27 0.63
28 0.64
29 0.68
30 0.67
31 0.72
32 0.72
33 0.73
34 0.73
35 0.73
36 0.72
37 0.69
38 0.6
39 0.56
40 0.52
41 0.43
42 0.37