Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6VAW0

Protein Details
Accession A0A0L6VAW0    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-79IHPADREKRKPRPVVRRTPTKKEVBasic
NLS Segment(s)
PositionSequence
62-73EKRKPRPVVRRT
113-116KKRA
120-132LSKGNQKKVSKAI
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MTLSHLVEKEVKATPLSSLPTFGSQWGKFFSDGSRRLSFNPNQMLKPSDLQLENLIHPADREKRKPRPVVRRTPTKKEVQLTDPFLYYNINILKEPYNPDLLANFITPLGRIKKRALTGLSKGNQKKVSKAIRRARCMGFLPYFGKPLERYSEDHQQRRDGPGVDLPHFAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.25
4 0.21
5 0.21
6 0.21
7 0.23
8 0.23
9 0.24
10 0.27
11 0.24
12 0.25
13 0.26
14 0.27
15 0.24
16 0.24
17 0.27
18 0.28
19 0.32
20 0.36
21 0.36
22 0.36
23 0.38
24 0.45
25 0.43
26 0.42
27 0.48
28 0.45
29 0.43
30 0.44
31 0.43
32 0.38
33 0.36
34 0.29
35 0.24
36 0.21
37 0.21
38 0.22
39 0.21
40 0.2
41 0.19
42 0.18
43 0.13
44 0.13
45 0.16
46 0.21
47 0.25
48 0.33
49 0.4
50 0.5
51 0.59
52 0.68
53 0.73
54 0.76
55 0.79
56 0.82
57 0.81
58 0.83
59 0.81
60 0.81
61 0.77
62 0.72
63 0.68
64 0.61
65 0.56
66 0.5
67 0.49
68 0.45
69 0.4
70 0.33
71 0.28
72 0.24
73 0.21
74 0.15
75 0.14
76 0.1
77 0.1
78 0.1
79 0.12
80 0.13
81 0.14
82 0.18
83 0.16
84 0.16
85 0.15
86 0.16
87 0.14
88 0.14
89 0.13
90 0.1
91 0.09
92 0.07
93 0.07
94 0.07
95 0.11
96 0.16
97 0.17
98 0.2
99 0.23
100 0.28
101 0.3
102 0.35
103 0.35
104 0.35
105 0.37
106 0.43
107 0.45
108 0.48
109 0.48
110 0.5
111 0.53
112 0.49
113 0.49
114 0.49
115 0.55
116 0.56
117 0.64
118 0.68
119 0.7
120 0.75
121 0.76
122 0.7
123 0.64
124 0.58
125 0.54
126 0.47
127 0.41
128 0.39
129 0.34
130 0.34
131 0.29
132 0.29
133 0.23
134 0.25
135 0.28
136 0.27
137 0.3
138 0.34
139 0.45
140 0.51
141 0.57
142 0.57
143 0.57
144 0.57
145 0.58
146 0.58
147 0.49
148 0.43
149 0.42
150 0.44
151 0.39