Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L6UYM0

Protein Details
Accession A0A0L6UYM0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
22-45LLLPKVCKAARRNKKENRKICEGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MNYETTDGEEDQEDNASEFLGLLLPKVCKAARRNKKENRKICEGQKELITISKEKMVVNQIVANNVVMSKDGAGATLLRNTTTQGKQRFRSKWGSNGLVELKEKVELFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.07
5 0.07
6 0.06
7 0.07
8 0.06
9 0.06
10 0.09
11 0.09
12 0.1
13 0.12
14 0.13
15 0.18
16 0.26
17 0.36
18 0.44
19 0.54
20 0.64
21 0.72
22 0.82
23 0.86
24 0.88
25 0.84
26 0.83
27 0.79
28 0.76
29 0.76
30 0.67
31 0.59
32 0.51
33 0.45
34 0.36
35 0.33
36 0.27
37 0.18
38 0.16
39 0.16
40 0.16
41 0.15
42 0.16
43 0.15
44 0.14
45 0.14
46 0.17
47 0.15
48 0.15
49 0.15
50 0.13
51 0.1
52 0.09
53 0.09
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.1
64 0.1
65 0.09
66 0.1
67 0.12
68 0.18
69 0.23
70 0.3
71 0.36
72 0.43
73 0.5
74 0.59
75 0.62
76 0.61
77 0.66
78 0.64
79 0.63
80 0.64
81 0.62
82 0.54
83 0.55
84 0.52
85 0.46
86 0.42
87 0.35
88 0.28
89 0.26